NOX5 (NADPH oxidase 5)

Gene

• Entrez ID: 79400
• Gene name: NADPH oxidase 5
• Gene symbol: NOX5
• Synonyms (NCBI Gene): -
• Chromosome: 15
• Chromosome location: 15q23
• Summary: This gene is predominantly expressed in the testis and lymphocyte-rich areas of spleen and lymph nodes. It encodes a calcium-dependen NADPH oxidase that generates superoxide, and functions as a calcium-dependent proton channel that may regulate redox-depe

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT664825	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT664824	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT664823	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT664822	hsa-miR-7977	HITS-CLIP	23824327
MIRT664821	hsa-miR-623	HITS-CLIP	23824327
MIRT664820	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT664819	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT664818	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT664817	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT664816	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT655782	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT655783	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT664815	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT655780	hsa-miR-8063	HITS-CLIP	23824327
MIRT655781	hsa-miR-4289	HITS-CLIP	23824327
MIRT655779	hsa-miR-205-5p	HITS-CLIP	23824327
MIRT655782	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT655783	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT655780	hsa-miR-8063	HITS-CLIP	23824327
MIRT655781	hsa-miR-4289	HITS-CLIP	23824327
MIRT655779	hsa-miR-205-5p	HITS-CLIP	23824327
MIRT655778	hsa-miR-3713	HITS-CLIP	23824327
MIRT532019	hsa-miR-892a	PAR-CLIP	22012620
MIRT532018	hsa-miR-4464	PAR-CLIP	22012620
MIRT532017	hsa-miR-4748	PAR-CLIP	22012620
MIRT532016	hsa-miR-181a-2-3p	PAR-CLIP	22012620
MIRT532015	hsa-miR-1273g-3p	PAR-CLIP	22012620
MIRT532014	hsa-miR-3616-3p	PAR-CLIP	22012620
MIRT532013	hsa-miR-5087	PAR-CLIP	22012620
MIRT532012	hsa-miR-4711-3p	PAR-CLIP	22012620
MIRT532011	hsa-miR-6509-3p	PAR-CLIP	22012620
MIRT532010	hsa-miR-3912-5p	PAR-CLIP	22012620
MIRT532009	hsa-miR-4646-3p	PAR-CLIP	22012620
MIRT532008	hsa-miR-2355-3p	PAR-CLIP	22012620
MIRT664825	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT664824	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT664823	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT664822	hsa-miR-7977	HITS-CLIP	23824327
MIRT664821	hsa-miR-623	HITS-CLIP	23824327
MIRT664820	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT664819	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT664818	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT664817	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT664816	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT655782	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT655783	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT664815	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT655780	hsa-miR-8063	HITS-CLIP	23824327
MIRT655781	hsa-miR-4289	HITS-CLIP	23824327
MIRT655779	hsa-miR-205-5p	HITS-CLIP	23824327
MIRT655782	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT655783	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT655780	hsa-miR-8063	HITS-CLIP	23824327
MIRT655781	hsa-miR-4289	HITS-CLIP	23824327
MIRT655779	hsa-miR-205-5p	HITS-CLIP	23824327
MIRT655778	hsa-miR-3713	HITS-CLIP	23824327
MIRT532019	hsa-miR-892a	PAR-CLIP	22012620
MIRT532018	hsa-miR-4464	PAR-CLIP	22012620
MIRT532017	hsa-miR-4748	PAR-CLIP	22012620
MIRT532016	hsa-miR-181a-2-3p	PAR-CLIP	22012620
MIRT532015	hsa-miR-1273g-3p	PAR-CLIP	22012620
MIRT532014	hsa-miR-3616-3p	PAR-CLIP	22012620
MIRT532013	hsa-miR-5087	PAR-CLIP	22012620
MIRT532012	hsa-miR-4711-3p	PAR-CLIP	22012620
MIRT532011	hsa-miR-6509-3p	PAR-CLIP	22012620
MIRT532010	hsa-miR-3912-5p	PAR-CLIP	22012620
MIRT532009	hsa-miR-4646-3p	PAR-CLIP	22012620
MIRT532008	hsa-miR-2355-3p	PAR-CLIP	22012620
MIRT1190282	hsa-miR-3138	CLIP-seq
MIRT1190283	hsa-miR-3650	CLIP-seq
MIRT1190284	hsa-miR-3674	CLIP-seq
MIRT1190285	hsa-miR-3911	CLIP-seq
MIRT1190286	hsa-miR-4260	CLIP-seq
MIRT1190287	hsa-miR-4729	CLIP-seq
MIRT1190288	hsa-miR-4800-5p	CLIP-seq
MIRT1190289	hsa-miR-486-3p	CLIP-seq
MIRT1190290	hsa-miR-590-3p	CLIP-seq
MIRT1551806	hsa-miR-1913	CLIP-seq
MIRT1551807	hsa-miR-324-3p	CLIP-seq
MIRT1551808	hsa-miR-4313	CLIP-seq
MIRT2465729	hsa-miR-124	CLIP-seq
MIRT2465730	hsa-miR-3120-3p	CLIP-seq
MIRT2465731	hsa-miR-4494	CLIP-seq
MIRT2465732	hsa-miR-4499	CLIP-seq
MIRT2465733	hsa-miR-4724-5p	CLIP-seq
MIRT2465734	hsa-miR-4771	CLIP-seq
MIRT2465735	hsa-miR-506	CLIP-seq
MIRT2465736	hsa-miR-922	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
JUN	Activation	22348975
NFKB1	Activation	22348975
RELA	Activation	22348975
STAT1	Activation	22348975
STAT3	Activation	22348975

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IDA	17275676
GO:0001525	Process	Angiogenesis	IEA
GO:0001819	Process	Positive regulation of cytokine production	NAS	11483596
GO:0001935	Process	Endothelial cell proliferation	IDA	17275676
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	17346712
GO:0005783	Component	Endoplasmic reticulum	IDA	17275676, 17587483
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	17587483, 36653838
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006915	Process	Apoptotic process	NAS	11483596
GO:0006952	Process	Defense response	IBA
GO:0015252	Function	Proton channel activity	IDA	11483596
GO:0016020	Component	Membrane	IEA
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IBA
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IDA	22427510
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IDA	11483596, 12686516, 17275676, 17587483, 22427510, 36653838
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IMP	14982937, 21319793, 21642394, 22387196, 24505490, 36653838
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0020037	Function	Heme binding	NAS	11483596
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0042554	Process	Superoxide anion generation	IBA
GO:0042554	Process	Superoxide anion generation	IDA	11483596
GO:0043012	Process	Regulation of fusion of sperm to egg plasma membrane	NAS	11483596
GO:0043020	Component	NADPH oxidase complex	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0050660	Function	Flavin adenine dinucleotide binding	NAS	11483596
GO:0050661	Function	NADP binding	NAS	11483596
GO:0050664	Function	Oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor	IEA
GO:0061640	Process	Cytoskeleton-dependent cytokinesis	NAS	11483596
GO:0106292	Function	Superoxide-generating NADPH oxidase activity	IEA
GO:1902600	Process	Proton transmembrane transport	IDA	11483596
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IDA	17275676

Other IDs

• MIM: 606572
• HGNC: 14874
• e!Ensembl: HGNC

Protein

• UniProt ID: Q96PH1
• Protein name: NADPH oxidase 5 (EC 1.6.3.-)
• Protein function: Calcium-dependent NADPH oxidase that catalyzes the generation of superoxide from molecular oxygen utilizing NADPH as an electron donor (PubMed:12686516). May play a role in cell growth and apoptosis (PubMed:12686516). {ECO:0000269|PubMed:1268651
• PDB: 6SZ5, 8U7Y, 8U85, 8U86, 8U87
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13405	EF-hand_6	61 → 89	EF-hand domain	Domain
  PF13202	EF-hand_5	171 → 197	EF hand	Domain
  PF01794	Ferric_reduct	271 → 413	Ferric reductase like transmembrane component	Family
  PF08022	FAD_binding_8	443 → 575	FAD-binding domain	Domain
  PF08030	NAD_binding_6	581 → 754	Ferric reductase NAD binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Mainly expressed in pachytene spermatocytes of testis and in lymphocyte-rich areas of spleen and lymph nodes. Also detected in ovary, placenta, pancreas, cardiac fibroblasts. Expressed in B-cells and prostate malignant cells. {ECO:0000
• Sequence:

  MNTSGDPAQTGPEGCRGTMSAEEDARWLRWVTQQFKTIAGEDGEISLQEFKAALHVKESF
  FAERFFALFDSDRSGTITLQELQEALTLLIHGSPMDKLKFLFQVYDIDVCARQGASAGTE
  WGAGAGPHWASSPLGTGSGSIDPDELRTVLQSCLRESAISLPDEKLDQLTLALFESADAD
  GNGAITFEELRDELQRFPGVMENLTISAAHWLTAPAPRPRPRRPRQLTRAYWHNHRSQLF
  CLATYAGLHVLLFGLAASAHRDLGASVMVAKGCGQCLNFDCSFIAVLMLRRCLTWLRATW
  LAQVLPLDQNIQFHQLMGYVVVGLSLVHTVAHTVNFVLQAQAEASPFQFWELLLTTRPGI
  GWVHGSASPTGVALLLLLLLMFICSSSCIRRSGHFEVFYWTHLSYLLVWLLLIFHGPNFW
  KWLLVPGILFFLEKAIGLAVSRMAAVCIMEVNLLPSKVTHLLIKRPPFFHYRPGDYLYLN
  IPTIARYEWHPFTISSAPEQKDTIWLHIRSQGQWTNRLYESFKASDPLGRGSKRLSRSVT
  MRKSQRSSKGSEILLEKHKFCNIKCYIDGPYGTPTRRIFASEHAVLIGAGIGITPFASIL
  QSIMYRHQKRKHTCPSCQHSWIEGVQDNMKLHKVDFIWINRDQRSFEWFVSLLTKLEMDQ
  AEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITGLQTRTQPGRPDW
  SKVFQKVAAEKKGKVQVFFCGSPALAKVLKGHCEKFGFRFFQENF

• Sequence length: 765

Pathways

Reactome:

Detoxification of Reactive Oxygen Species

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	LHGDN	17947454		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	25818486		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	16707484, 17403674, 17947454, 19926617, 20086178, 20576920, 21525435, 21750116, 24699332, 26901778		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	26109726		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	24180474, 31565149		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	19022160, 34269800, 34273166	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24180474, 31565149		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	31565149	Stimulate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	16707484	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	17403674, 17947454, 20576920, 24699332, 25818486, 26901778, 27415609, 31700071		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	31700071	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28034671, 31019654		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26513170, 39219290	Associate	★☆☆☆☆ Found in Text Mining only
CADASIL Syndrome	CADASIL Syndrome	BEFREE	31647781		★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	34273166	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28894215	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	22503554	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30334629		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30882364		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30882367		★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	LHGDN	17089090		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31366537		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	24505490		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	19022160	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	24505490		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	19022160	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24505490		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24262797, 24505490, 28747378, 31222503		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24262797, 24505490, 28747378, 31222503		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	39529984	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	24262797, 25415612, 28747378, 31222503		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	28034671		★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	16285965		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	24688893		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22931418		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22931418		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	31222503		★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	36690264	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	22503554		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	34269800	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	28762556	Stimulate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	30686516		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28747378		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	24688893	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	24262797, 30334629		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	40222298	Stimulate	★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	22503554		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	24262797, 25415612		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	22503554	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	26109726		★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	16339585	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	26109726		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23533664	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	28762556	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	32428157	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28034671, 31019654		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12686516, 22931418, 25559363, 25818486, 28762556		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24505490, 26109726, 28762556, 30801870, 31423287		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31366537		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28762556		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	28762556	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	29166648	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31345363		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	22503554		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	22503554	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28762556		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12686516, 22931418, 25559363, 25818486, 28762556		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12686516, 25559363	Associate	★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31222503		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	24262797		★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	34273166	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	24505490		★☆☆☆☆ Found in Text Mining only