CALB2 (calbindin 2)

Gene

• Entrez ID: 794
• Gene name: Calbindin 2
• Gene symbol: CALB2
• Synonyms (NCBI Gene): CAB29, CAL2, CR
• Chromosome: 16
• Chromosome location: 16q22.2
• Summary: This gene encodes an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. This protein plays a role in diverse cellular functions, including message targ

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018745	hsa-miR-335-5p	Microarray	18185580
MIRT858748	hsa-miR-1231	CLIP-seq
MIRT858749	hsa-miR-1267	CLIP-seq
MIRT858750	hsa-miR-1275	CLIP-seq
MIRT858751	hsa-miR-1293	CLIP-seq
MIRT858752	hsa-miR-2467-3p	CLIP-seq
MIRT858753	hsa-miR-298	CLIP-seq
MIRT858754	hsa-miR-30a	CLIP-seq
MIRT858755	hsa-miR-30b	CLIP-seq
MIRT858756	hsa-miR-30c	CLIP-seq
MIRT858757	hsa-miR-30d	CLIP-seq
MIRT858758	hsa-miR-30e	CLIP-seq
MIRT858759	hsa-miR-3123	CLIP-seq
MIRT858760	hsa-miR-3127-5p	CLIP-seq
MIRT858761	hsa-miR-3132	CLIP-seq
MIRT858762	hsa-miR-3144-5p	CLIP-seq
MIRT858763	hsa-miR-3162-5p	CLIP-seq
MIRT858764	hsa-miR-3170	CLIP-seq
MIRT858765	hsa-miR-342-5p	CLIP-seq
MIRT858766	hsa-miR-3529	CLIP-seq
MIRT858767	hsa-miR-3607-3p	CLIP-seq
MIRT858768	hsa-miR-3622b-5p	CLIP-seq
MIRT858769	hsa-miR-3664-5p	CLIP-seq
MIRT858770	hsa-miR-3670	CLIP-seq
MIRT858771	hsa-miR-3686	CLIP-seq
MIRT858772	hsa-miR-376c	CLIP-seq
MIRT858773	hsa-miR-379	CLIP-seq
MIRT858774	hsa-miR-3918	CLIP-seq
MIRT858775	hsa-miR-3921	CLIP-seq
MIRT858776	hsa-miR-4260	CLIP-seq
MIRT858777	hsa-miR-4288	CLIP-seq
MIRT858778	hsa-miR-4300	CLIP-seq
MIRT858779	hsa-miR-4313	CLIP-seq
MIRT858780	hsa-miR-4419a	CLIP-seq
MIRT858781	hsa-miR-4436b-3p	CLIP-seq
MIRT858782	hsa-miR-4483	CLIP-seq
MIRT858783	hsa-miR-4510	CLIP-seq
MIRT858784	hsa-miR-4520a-3p	CLIP-seq
MIRT858785	hsa-miR-4520b-3p	CLIP-seq
MIRT858786	hsa-miR-4525	CLIP-seq
MIRT858787	hsa-miR-4651	CLIP-seq
MIRT858788	hsa-miR-4653-5p	CLIP-seq
MIRT858789	hsa-miR-4664-5p	CLIP-seq
MIRT858790	hsa-miR-4665-5p	CLIP-seq
MIRT858791	hsa-miR-4682	CLIP-seq
MIRT858792	hsa-miR-4711-5p	CLIP-seq
MIRT858793	hsa-miR-4716-5p	CLIP-seq
MIRT858794	hsa-miR-4723-5p	CLIP-seq
MIRT858795	hsa-miR-4778-3p	CLIP-seq
MIRT858796	hsa-miR-485-3p	CLIP-seq
MIRT858797	hsa-miR-487a	CLIP-seq
MIRT858798	hsa-miR-490-3p	CLIP-seq
MIRT858799	hsa-miR-587	CLIP-seq
MIRT858800	hsa-miR-593	CLIP-seq
MIRT858801	hsa-miR-608	CLIP-seq
MIRT858802	hsa-miR-619	CLIP-seq
MIRT858803	hsa-miR-625	CLIP-seq
MIRT858804	hsa-miR-627	CLIP-seq
MIRT858805	hsa-miR-632	CLIP-seq
MIRT858806	hsa-miR-9	CLIP-seq
MIRT858807	hsa-miR-920	CLIP-seq
MIRT858808	hsa-miR-922	CLIP-seq
MIRT858809	hsa-miR-924	CLIP-seq
MIRT858810	hsa-miR-939	CLIP-seq
MIRT858750	hsa-miR-1275	CLIP-seq
MIRT858753	hsa-miR-298	CLIP-seq
MIRT858754	hsa-miR-30a	CLIP-seq
MIRT858755	hsa-miR-30b	CLIP-seq
MIRT858756	hsa-miR-30c	CLIP-seq
MIRT858757	hsa-miR-30d	CLIP-seq
MIRT858758	hsa-miR-30e	CLIP-seq
MIRT858759	hsa-miR-3123	CLIP-seq
MIRT858760	hsa-miR-3127-5p	CLIP-seq
MIRT858763	hsa-miR-3162-5p	CLIP-seq
MIRT1954962	hsa-miR-3689d	CLIP-seq
MIRT858774	hsa-miR-3918	CLIP-seq
MIRT858779	hsa-miR-4313	CLIP-seq
MIRT858781	hsa-miR-4436b-3p	CLIP-seq
MIRT858786	hsa-miR-4525	CLIP-seq
MIRT858790	hsa-miR-4665-5p	CLIP-seq
MIRT858792	hsa-miR-4711-5p	CLIP-seq
MIRT858793	hsa-miR-4716-5p	CLIP-seq
MIRT858794	hsa-miR-4723-5p	CLIP-seq
MIRT858803	hsa-miR-625	CLIP-seq
MIRT858808	hsa-miR-922	CLIP-seq
MIRT858750	hsa-miR-1275	CLIP-seq
MIRT2192584	hsa-miR-22	CLIP-seq
MIRT858776	hsa-miR-4260	CLIP-seq
MIRT858786	hsa-miR-4525	CLIP-seq
MIRT858787	hsa-miR-4651	CLIP-seq
MIRT858790	hsa-miR-4665-5p	CLIP-seq
MIRT858794	hsa-miR-4723-5p	CLIP-seq
MIRT858801	hsa-miR-608	CLIP-seq
MIRT858803	hsa-miR-625	CLIP-seq
MIRT858770	hsa-miR-3670	CLIP-seq
MIRT858778	hsa-miR-4300	CLIP-seq
MIRT858780	hsa-miR-4419a	CLIP-seq
MIRT858783	hsa-miR-4510	CLIP-seq
MIRT858792	hsa-miR-4711-5p	CLIP-seq
MIRT858807	hsa-miR-920	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005921	Component	Gap junction	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	ISS
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0032420	Component	Stereocilium	IEA
GO:0032437	Component	Cuticular plate	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043195	Component	Terminal bouton	IBA
GO:0044293	Component	Dendriole	IEA
GO:0044293	Component	Dendriole	ISS
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048167	Process	Regulation of synaptic plasticity	IEA
GO:0048167	Process	Regulation of synaptic plasticity	ISS
GO:0098688	Component	Parallel fiber to Purkinje cell synapse	IEA
GO:0098688	Component	Parallel fiber to Purkinje cell synapse	ISS
GO:0099509	Process	Regulation of presynaptic cytosolic calcium ion concentration	IEA
GO:0099534	Function	Calcium ion binding involved in regulation of presynaptic cytosolic calcium ion concentration	IEA
GO:0099534	Function	Calcium ion binding involved in regulation of presynaptic cytosolic calcium ion concentration	ISS
GO:0099536	Process	Synaptic signaling	IEA
GO:0099536	Process	Synaptic signaling	ISS

Other IDs

• MIM: 114051
• HGNC: 1435
• e!Ensembl: ENSG00000172137

Protein

• UniProt ID: P22676
• Protein name: Calretinin (CR) (29 kDa calbindin)
• Protein function: Calcium-binding protein involved in calcium homeostasis and signal transduction. It plays a critical role in buffering intracellular calcium levels and modulating calcium-dependent signaling pathways (PubMed:2001709). Predominantly expressed in
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13499	EF-hand_7	18 → 92	EF-hand domain pair	Domain
  PF13499	EF-hand_7	109 → 180	EF-hand domain pair	Domain
  PF13202	EF-hand_5	157 → 180	EF hand	Domain
  PF13405	EF-hand_6	199 → 234	EF-hand domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Brain.
• Sequence:

  MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSK
  SDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYD
  TDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLL
  PVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQL
  TNYRKSVMSLAEAGKLYRKDLEIVLCSEPPM

• Sequence length: 271

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS 1	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERITONEAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	10366153, 15093134, 15736446, 28862203, 30354850		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	8864572		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29327712, 30711938		★☆☆☆☆ Found in Text Mining only
Aganglionosis, Colonic	Colonic Aganglionosis	BEFREE	31387515		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	24028428	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	18223328		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	LHGDN	18223328, 18269580		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28294153		★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	CTD_human_DG	11796754		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	CTD_human_DG	11796754		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	CTD_human_DG	11796754		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29025836		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	29940585	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29177493		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	29177493		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	38193226	Associate	★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	21226980		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28550498		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24322014	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	30819647		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	21226980		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18214032, 19435792, 31671889	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15736446, 20932060, 30148742		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	24262018	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	33432559	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	24262018	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	24262018	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	24437456	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25346242, 27761727		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33432559, 35963640	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	12610103, 17361207	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35417384	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	16415794	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	31012094		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31509615		★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	CTD_human_DG	22784439		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30549027		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	30549027	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	33600772	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18214032, 19998412, 23265355		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	18214032		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	18214032, 8898855	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21629658		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18214032, 21629658, 27062033, 37664836	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	40026415	Associate	★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	28059101		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30930749		★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	22531174	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	26230373, 29509279		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	29509279, 35623352	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	28963059		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28206669, 28315308		★☆☆☆☆ Found in Text Mining only
Ethylmalonic encephalopathy	Ethylmalonic Encephalopathy	BEFREE	28963059		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	28286184		★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	34301297	Associate	★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	34301297	Associate	★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	28158993		★☆☆☆☆ Found in Text Mining only
Focal Segmental Glomerulosclerosis, Not Otherwise Specified	Focal segmental glomerulosclerosis	BEFREE	28158993		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	12610103	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	28158993	Stimulate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	15220363	Inhibit	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	24294384, 28139502	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	26230373, 27755344, 28139502, 28341231, 28508695, 28649946, 29212517, 29304518, 30175382, 30413921, 30915893, 31387515		★☆☆☆☆ Found in Text Mining only
Holoprosencephaly	Holoprosencephaly	Pubtator	19234067	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	22891683, 28168621		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29025836		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30549027		★☆☆☆☆ Found in Text Mining only
Keratocystic Odontogenic Tumor	Keratocystic Odontogenic Tumor	BEFREE	18223328		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	12610103	Associate	★☆☆☆☆ Found in Text Mining only
Leydig Cell Tumor	Leydig Cell Tumor	BEFREE	25511291		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	30141078		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	25346242		★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	28158993		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	21226980		★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	30549027	Associate	★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	11396148, 15093134, 17115439, 17574962, 18306350, 23595591, 28558669, 29025836, 29699512, 30254313, 30545133, 30555628, 30711938, 31671889		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	22784439		★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	17062665, 26729015		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25346242		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31509615		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11299732, 23151231, 23595591, 25346242, 29025836, 29059099, 31554354, 9854474		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18214032, 19998412		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29785016		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	LHGDN	18992917		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30930749		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	11299732, 15736446, 17361207, 19998412, 21574263, 23265355, 23595591, 26848772, 28463437, 28558669, 29327712, 30354850, 30555628, 31671889		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	11570906, 15736446, 16056246, 16415794, 16554731, 17361207, 19435792, 23041828, 26848772	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	12194995, 15736446, 16206294, 17361207, 18098206, 22011651, 22531174, 28922567, 30545133, 31671889, 32727552, 33432559, 36557076, 38038422, 38203360, 38280040	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	25400801	Stimulate	★☆☆☆☆ Found in Text Mining only
Microcystic stromal tumor	Microcystic Stromal Tumor	BEFREE	29132723, 30325056		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	32929772	Associate	★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	27686170, 30606612		★☆☆☆☆ Found in Text Mining only
Myxoma	Myxoma	BEFREE	11642722, 14633612, 21298650		★☆☆☆☆ Found in Text Mining only
Myxoma	Myxoma	LHGDN	11642722		★☆☆☆☆ Found in Text Mining only
Myxoma of heart	Myxoma Of Heart	BEFREE	11642722		★☆☆☆☆ Found in Text Mining only
Myxoma of the Endocardium	Myxoma Of The Endocardium	BEFREE	11642722		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	16206294	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10366153, 15492758, 16203775, 17361207, 21205078, 24594996, 26848772, 27324529, 28550498, 29250651, 30545133, 30555628, 31173483, 31671889		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	12640103, 30558081		★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	28158993	Associate	★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	30549027		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29250651, 31509615		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23011824	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	29705715		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33432559	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28168621		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36952070, 40715263	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	20190734	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal Neoplasms	CTD_human_DG	22784439		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	29177493		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	30606612		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	29025836		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	12946229, 17361207	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	26685084		★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	11411458, 17106529	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12867516, 26337038, 31118643		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	26198764		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seminoma	Seminoma	BEFREE	25511291		★☆☆☆☆ Found in Text Mining only
Sex Cord-Stromal Tumor	Sex Cord-Stromal Tumor	BEFREE	21378549		★☆☆☆☆ Found in Text Mining only
Sialic Acid Storage Disease, Finnish Type (disorder)	Sialic Acid Storage Disease	BEFREE	30459554		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28315308		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	25511291		★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	31250082		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	CTD_human_DG	19578012		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Varicosity	Vulval varices	BEFREE	29574743		★☆☆☆☆ Found in Text Mining only