Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	79370
Gene name	BCL2 like 14
Gene symbol	BCL2L14
Synonyms (NCBI Gene)	BCLG
Chromosome	12
Chromosome location	12p13.2
Summary	The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. Overexpression of this gene has be

Show/Hide all (65)

miRTarBase ID	miRNA	Experiments	Reference
MIRT450423	hsa-miR-3663-5p	PAR-CLIP	22100165
MIRT450422	hsa-miR-4677-3p	PAR-CLIP	22100165
MIRT450421	hsa-miR-4679	PAR-CLIP	22100165
MIRT450420	hsa-miR-4635	PAR-CLIP	22100165
MIRT450419	hsa-miR-570-3p	PAR-CLIP	22100165
MIRT450418	hsa-miR-8069	PAR-CLIP	22100165
MIRT450417	hsa-miR-4527	PAR-CLIP	22100165
MIRT450416	hsa-miR-6503-5p	PAR-CLIP	22100165
MIRT450415	hsa-miR-6753-3p	PAR-CLIP	22100165
MIRT450414	hsa-miR-7107-3p	PAR-CLIP	22100165
MIRT735759	hsa-miR-486-3p	Luciferase reporter assayWestern blottingqRT-PCR	31815358
MIRT735760	hsa-miR-663a	Luciferase reporter assayWestern blottingqRT-PCR	31815358
MIRT450423	hsa-miR-3663-5p	PAR-CLIP	22100165
MIRT450422	hsa-miR-4677-3p	PAR-CLIP	22100165
MIRT450421	hsa-miR-4679	PAR-CLIP	22100165
MIRT450420	hsa-miR-4635	PAR-CLIP	22100165
MIRT450419	hsa-miR-570-3p	PAR-CLIP	22100165
MIRT450418	hsa-miR-8069	PAR-CLIP	22100165
MIRT450417	hsa-miR-4527	PAR-CLIP	22100165
MIRT450416	hsa-miR-6503-5p	PAR-CLIP	22100165
MIRT450415	hsa-miR-6753-3p	PAR-CLIP	22100165
MIRT450414	hsa-miR-7107-3p	PAR-CLIP	22100165
MIRT819019	hsa-miR-101	CLIP-seq
MIRT819020	hsa-miR-1200	CLIP-seq
MIRT819021	hsa-miR-144	CLIP-seq
MIRT819022	hsa-miR-186	CLIP-seq
MIRT819023	hsa-miR-4502	CLIP-seq
MIRT819024	hsa-miR-4539	CLIP-seq
MIRT819025	hsa-miR-4762-5p	CLIP-seq
MIRT819026	hsa-miR-4797-3p	CLIP-seq
MIRT819027	hsa-miR-496	CLIP-seq
MIRT2180855	hsa-miR-1915	CLIP-seq
MIRT2180856	hsa-miR-3185	CLIP-seq
MIRT2180857	hsa-miR-3189-3p	CLIP-seq
MIRT2180858	hsa-miR-3649	CLIP-seq
MIRT2180859	hsa-miR-4726-3p	CLIP-seq
MIRT2180860	hsa-miR-4747-5p	CLIP-seq
MIRT2444752	hsa-miR-125a-5p	CLIP-seq
MIRT2444753	hsa-miR-125b	CLIP-seq
MIRT2180856	hsa-miR-3185	CLIP-seq
MIRT2444754	hsa-miR-4281	CLIP-seq
MIRT2444755	hsa-miR-4319	CLIP-seq
MIRT2444756	hsa-miR-4732-3p	CLIP-seq
MIRT2180860	hsa-miR-4747-5p	CLIP-seq
MIRT2444757	hsa-miR-670	CLIP-seq
MIRT2444752	hsa-miR-125a-5p	CLIP-seq
MIRT2444753	hsa-miR-125b	CLIP-seq
MIRT2484333	hsa-miR-1295	CLIP-seq
MIRT2180856	hsa-miR-3185	CLIP-seq
MIRT2484334	hsa-miR-4280	CLIP-seq
MIRT2444754	hsa-miR-4281	CLIP-seq
MIRT2444755	hsa-miR-4319	CLIP-seq
MIRT2484335	hsa-miR-4703-3p	CLIP-seq
MIRT2484336	hsa-miR-4717-5p	CLIP-seq
MIRT2444756	hsa-miR-4732-3p	CLIP-seq
MIRT2180860	hsa-miR-4747-5p	CLIP-seq
MIRT2444757	hsa-miR-670	CLIP-seq
MIRT2444752	hsa-miR-125a-5p	CLIP-seq
MIRT2444753	hsa-miR-125b	CLIP-seq
MIRT2180856	hsa-miR-3185	CLIP-seq
MIRT2444754	hsa-miR-4281	CLIP-seq
MIRT2444755	hsa-miR-4319	CLIP-seq
MIRT2444756	hsa-miR-4732-3p	CLIP-seq
MIRT2180860	hsa-miR-4747-5p	CLIP-seq
MIRT2444757	hsa-miR-670	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	11054413, 17280616, 30833792, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	11054413
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	IDA	17280616
GO:0006915	Process	Apoptotic process	IEA
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	17280616
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043229	Component	Intracellular organelle	IDA	11054413
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IDA	11054413

MIM	HGNC	e!Ensembl
606126	16657	ENSG00000121380

Q9BZR8

Protein name

Apoptosis facilitator Bcl-2-like protein 14 (Bcl2-L-14) (Apoptosis regulator Bcl-G)

Protein function

Plays a role in apoptosis.

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is widely expressed. Isoform 2 is testis-specific. {ECO:0000269|PubMed:11054413}.

Sequence

MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGN
CSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTL
EYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEI
FVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDG
LSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKY
LKENFSPWIQQHGGWEKILGISHEEVD

Sequence length

327

Interactions

View interactions

	Reactome
			TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONNECTIVE TISSUE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	19671159, 32321829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30075151	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17280616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly	Clinodactyly	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31988296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CORONARY ARTERY DISEASE, AUTOSOMAL DOMINANT 2 (disorder)	Coronary artery disease	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31988296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25213837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14999772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30075151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14999772		★★★★★ ★☆☆☆☆ Found in Text Mining only
TOOTH AGENESIS, SELECTIVE, 7	Tooth Agenesis	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30075151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30075151, 32321829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

BCL2L14 (BCL2 like 14)