Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	79191
Gene name	Iroquois homeobox 3
Gene symbol	IRX3
Synonyms (NCBI Gene)	IRX-1IRXB1
Chromosome	16
Chromosome location	16q12.2
Summary	IRX3 is a member of the Iroquois homeobox gene family (see IRX1; MIM 606197) and plays a role in an early step of neural development (Bellefroid et al., 1998 [PubMed 9427753]). Members of this family appear to play multiple roles during pattern formation

126

Show/Hide all (126)

miRTarBase ID	miRNA	Experiments
MIRT1072323	hsa-miR-1227	CLIP-seq
MIRT1072324	hsa-miR-1284	CLIP-seq
MIRT1072325	hsa-miR-2110	CLIP-seq
MIRT1072326	hsa-miR-300	CLIP-seq
MIRT1072327	hsa-miR-3064-3p	CLIP-seq
MIRT1072328	hsa-miR-3121-3p	CLIP-seq
MIRT1072329	hsa-miR-3140-3p	CLIP-seq
MIRT1072330	hsa-miR-3150a-3p	CLIP-seq
MIRT1072331	hsa-miR-3150b-3p	CLIP-seq
MIRT1072332	hsa-miR-3169	CLIP-seq
MIRT1072333	hsa-miR-3175	CLIP-seq
MIRT1072334	hsa-miR-329	CLIP-seq
MIRT1072335	hsa-miR-331-5p	CLIP-seq
MIRT1072336	hsa-miR-342-5p	CLIP-seq
MIRT1072337	hsa-miR-362-3p	CLIP-seq
MIRT1072338	hsa-miR-3687	CLIP-seq
MIRT1072339	hsa-miR-377	CLIP-seq
MIRT1072340	hsa-miR-381	CLIP-seq
MIRT1072341	hsa-miR-382	CLIP-seq
MIRT1072342	hsa-miR-3941	CLIP-seq
MIRT1072343	hsa-miR-3973	CLIP-seq
MIRT1072344	hsa-miR-4442	CLIP-seq
MIRT1072345	hsa-miR-4446-3p	CLIP-seq
MIRT1072346	hsa-miR-4515	CLIP-seq
MIRT1072347	hsa-miR-4656	CLIP-seq
MIRT1072348	hsa-miR-4660	CLIP-seq
MIRT1072349	hsa-miR-4662a-5p	CLIP-seq
MIRT1072350	hsa-miR-4664-5p	CLIP-seq
MIRT1072351	hsa-miR-4666-3p	CLIP-seq
MIRT1072352	hsa-miR-4678	CLIP-seq
MIRT1072353	hsa-miR-4689	CLIP-seq
MIRT1072354	hsa-miR-4706	CLIP-seq
MIRT1072355	hsa-miR-4721	CLIP-seq
MIRT1072356	hsa-miR-4728-5p	CLIP-seq
MIRT1072357	hsa-miR-4729	CLIP-seq
MIRT1072358	hsa-miR-4742-3p	CLIP-seq
MIRT1072359	hsa-miR-4749-5p	CLIP-seq
MIRT1072360	hsa-miR-4768-5p	CLIP-seq
MIRT1072361	hsa-miR-4784	CLIP-seq
MIRT1072362	hsa-miR-4789-3p	CLIP-seq
MIRT1072363	hsa-miR-4789-5p	CLIP-seq
MIRT1072364	hsa-miR-4796-3p	CLIP-seq
MIRT1072365	hsa-miR-4797-5p	CLIP-seq
MIRT1072366	hsa-miR-495	CLIP-seq
MIRT1072367	hsa-miR-520g	CLIP-seq
MIRT1072368	hsa-miR-520h	CLIP-seq
MIRT1072369	hsa-miR-556-3p	CLIP-seq
MIRT1072370	hsa-miR-561	CLIP-seq
MIRT1072371	hsa-miR-602	CLIP-seq
MIRT1072372	hsa-miR-603	CLIP-seq
MIRT1072373	hsa-miR-646	CLIP-seq
MIRT1072374	hsa-miR-659	CLIP-seq
MIRT1072375	hsa-miR-744	CLIP-seq
MIRT1072376	hsa-miR-885-3p	CLIP-seq
MIRT1072377	hsa-miR-939	CLIP-seq
MIRT1072378	hsa-miR-944	CLIP-seq
MIRT2017857	hsa-miR-1229	CLIP-seq
MIRT1072324	hsa-miR-1284	CLIP-seq
MIRT1072328	hsa-miR-3121-3p	CLIP-seq
MIRT1072335	hsa-miR-331-5p	CLIP-seq
MIRT1072339	hsa-miR-377	CLIP-seq
MIRT1072341	hsa-miR-382	CLIP-seq
MIRT1072343	hsa-miR-3973	CLIP-seq
MIRT2017858	hsa-miR-4420	CLIP-seq
MIRT1072348	hsa-miR-4660	CLIP-seq
MIRT1072349	hsa-miR-4662a-5p	CLIP-seq
MIRT1072352	hsa-miR-4678	CLIP-seq
MIRT1072357	hsa-miR-4729	CLIP-seq
MIRT2017859	hsa-miR-4738-3p	CLIP-seq
MIRT1072358	hsa-miR-4742-3p	CLIP-seq
MIRT1072360	hsa-miR-4768-5p	CLIP-seq
MIRT1072362	hsa-miR-4789-3p	CLIP-seq
MIRT1072363	hsa-miR-4789-5p	CLIP-seq
MIRT1072364	hsa-miR-4796-3p	CLIP-seq
MIRT1072367	hsa-miR-520g	CLIP-seq
MIRT1072368	hsa-miR-520h	CLIP-seq
MIRT1072371	hsa-miR-602	CLIP-seq
MIRT1072373	hsa-miR-646	CLIP-seq
MIRT1072374	hsa-miR-659	CLIP-seq
MIRT1072376	hsa-miR-885-3p	CLIP-seq
MIRT1072323	hsa-miR-1227	CLIP-seq
MIRT1072325	hsa-miR-2110	CLIP-seq
MIRT1072327	hsa-miR-3064-3p	CLIP-seq
MIRT1072328	hsa-miR-3121-3p	CLIP-seq
MIRT1072330	hsa-miR-3150a-3p	CLIP-seq
MIRT1072331	hsa-miR-3150b-3p	CLIP-seq
MIRT2249658	hsa-miR-3166	CLIP-seq
MIRT1072332	hsa-miR-3169	CLIP-seq
MIRT1072333	hsa-miR-3175	CLIP-seq
MIRT1072334	hsa-miR-329	CLIP-seq
MIRT1072336	hsa-miR-342-5p	CLIP-seq
MIRT1072337	hsa-miR-362-3p	CLIP-seq
MIRT2249659	hsa-miR-3714	CLIP-seq
MIRT1072342	hsa-miR-3941	CLIP-seq
MIRT1072343	hsa-miR-3973	CLIP-seq
MIRT1072345	hsa-miR-4446-3p	CLIP-seq
MIRT1072346	hsa-miR-4515	CLIP-seq
MIRT1072347	hsa-miR-4656	CLIP-seq
MIRT1072348	hsa-miR-4660	CLIP-seq
MIRT1072349	hsa-miR-4662a-5p	CLIP-seq
MIRT1072350	hsa-miR-4664-5p	CLIP-seq
MIRT1072353	hsa-miR-4689	CLIP-seq
MIRT1072354	hsa-miR-4706	CLIP-seq
MIRT1072355	hsa-miR-4721	CLIP-seq
MIRT1072356	hsa-miR-4728-5p	CLIP-seq
MIRT1072357	hsa-miR-4729	CLIP-seq
MIRT1072358	hsa-miR-4742-3p	CLIP-seq
MIRT1072359	hsa-miR-4749-5p	CLIP-seq
MIRT1072360	hsa-miR-4768-5p	CLIP-seq
MIRT1072361	hsa-miR-4784	CLIP-seq
MIRT1072363	hsa-miR-4789-5p	CLIP-seq
MIRT1072364	hsa-miR-4796-3p	CLIP-seq
MIRT1072366	hsa-miR-495	CLIP-seq
MIRT1072367	hsa-miR-520g	CLIP-seq
MIRT1072368	hsa-miR-520h	CLIP-seq
MIRT2249660	hsa-miR-548an	CLIP-seq
MIRT2249661	hsa-miR-550b	CLIP-seq
MIRT1072372	hsa-miR-603	CLIP-seq
MIRT1072373	hsa-miR-646	CLIP-seq
MIRT1072375	hsa-miR-744	CLIP-seq
MIRT1072376	hsa-miR-885-3p	CLIP-seq
MIRT1072377	hsa-miR-939	CLIP-seq
MIRT1072338	hsa-miR-3687	CLIP-seq
MIRT1072344	hsa-miR-4442	CLIP-seq
MIRT1072338	hsa-miR-3687	CLIP-seq
MIRT1072344	hsa-miR-4442	CLIP-seq

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS	21825130
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS	21825130
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS	21825130
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS	21825130
GO:0001656	Process	Metanephros development	IEA
GO:0003165	Process	Purkinje myocyte development	IEA
GO:0003165	Process	Purkinje myocyte development	ISS
GO:0003167	Process	Atrioventricular bundle cell differentiation	IEA
GO:0003167	Process	Atrioventricular bundle cell differentiation	ISS
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007498	Process	Mesoderm development	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030424	Component	Axon	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS	21825130
GO:0048468	Process	Cell development	IBA
GO:0060932	Process	His-Purkinje system cell differentiation	IEA
GO:0060932	Process	His-Purkinje system cell differentiation	ISS
GO:0072047	Process	Proximal/distal pattern formation involved in nephron development	IEA
GO:0072086	Process	Specification of loop of Henle identity	IEA
GO:0097009	Process	Energy homeostasis	IEA
GO:0097009	Process	Energy homeostasis	ISS
GO:1901844	Process	Regulation of cell communication by electrical coupling involved in cardiac conduction	IEA
GO:1901844	Process	Regulation of cell communication by electrical coupling involved in cardiac conduction	ISS	21825130
GO:1903598	Process	Positive regulation of gap junction assembly	IEA
GO:1903598	Process	Positive regulation of gap junction assembly	ISS	21825130
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
612985	14360	ENSG00000177508

P78415

Protein name

Iroquois-class homeodomain protein IRX-3 (Homeodomain protein IRXB1) (Iroquois homeobox protein 3)

Protein function

Transcription factor involved in SHH-dependent neural patterning. Together with NKX2-2 and NKX6-1 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. Belongs to the class I proteins of neuronal progenit

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05920	Homeobox_KN	145 → 184	Homeobox KN domain	Family

Sequence

MSFPQLGYQYIRPLYPSERPGAAGGSGGSAGARGGLGAGASELNASGSLSNVLSSVYGAP
YAAAAAAAAAQGYGAFLPYAAELPIFPQLGAQYELKDSPGVQHPAAAAAFPHPHPAFYPY
GQYQFGDPSRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFAN
ARRRLKKENKMTWAPRSRTDEEGNAYGSEREEEDEEEDEEDGKRELELEEEELGGEEEDT
GGEGLADDDEDEEIDLENLDGAATEPELSLAGAARRDGDLGLGPISDSKNSDSEDSSEGL
EDRPLPVLSLAPAPPPVAVASPSLPSPPVSLDPCAPAPAPASALQKPKIWSLAETATSPD
NPRRSPPGAGGSPPGAAVAPSALQLSPAAAAAAAHRLVSAPLGKFPAWTNRPFPGPPPGP
RLHPLSLLGSAPPHLLGLPGAAGHPAAAAAFARPAEPEGGTDRCSALEVEKKLLKTAFQP
VPRRPQNHLDAALVLSALSSS

Sequence length

501

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (26)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	29346763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	37697352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Body Weight	Body weight	Pubtator	36415696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29220587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20080751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	35957832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	33539429	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	27560134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35328612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29346763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27222047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	CTD_human_DG	21238641		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoid leukemia	Lymphoid leukemia	BEFREE	29346763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29220587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	38077400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	36415696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28316138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16952911, 20847289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	30246301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20080751, 24646999, 25224490, 26440677, 26627093, 27650258, 28316138, 28988979, 29346763, 30522931, 30713021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26440677, 27560134, 30166627, 31126299, 31771407, 32651404, 34399781, 36415696, 37433298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	29346763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	29346763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	29346763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	35957832	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tachycardia, Ventricular	Ventricular tachycardia	BEFREE	23509962		★★★★★ ★☆☆☆☆ Found in Text Mining only

IRX3 (iroquois homeobox 3)