PRRC2A (proline rich coiled-coil 2A)

Gene

• Entrez ID: 7916
• Gene name: Proline rich coiled-coil 2A
• Gene symbol: PRRC2A
• Synonyms (NCBI Gene): BAT2, D6S51, D6S51E, G2
• Chromosome: 6
• Chromosome location: 6p21.33
• Summary: A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. This gene has microsatellite repeats which are associated wi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005234	hsa-let-7b-5p	pSILAC	18668040
MIRT005234	hsa-let-7b-5p	Proteomics	18668040
MIRT005234	hsa-let-7b-5p	CLASH	23622248
MIRT005234	hsa-let-7b-5p	CLASH	23622248
MIRT005234	hsa-let-7b-5p	CLASH	23622248
MIRT051744	hsa-let-7c-5p	CLASH	23622248
MIRT051617	hsa-let-7e-5p	CLASH	23622248
MIRT050337	hsa-miR-25-3p	CLASH	23622248
MIRT048319	hsa-miR-106a-5p	CLASH	23622248
MIRT046673	hsa-miR-222-3p	CLASH	23622248
MIRT046673	hsa-miR-222-3p	CLASH	23622248
MIRT043314	hsa-miR-331-3p	CLASH	23622248
MIRT041837	hsa-miR-484	CLASH	23622248
MIRT041320	hsa-miR-193b-3p	CLASH	23622248
MIRT040800	hsa-miR-18a-3p	CLASH	23622248
MIRT040729	hsa-miR-92b-3p	CLASH	23622248
MIRT039872	hsa-miR-615-3p	CLASH	23622248
MIRT039872	hsa-miR-615-3p	CLASH	23622248
MIRT038861	hsa-miR-93-3p	CLASH	23622248
MIRT038490	hsa-miR-296-3p	CLASH	23622248
MIRT038238	hsa-miR-330-5p	CLASH	23622248
MIRT038145	hsa-miR-423-5p	CLASH	23622248
MIRT037410	hsa-miR-744-5p	CLASH	23622248
MIRT037162	hsa-miR-877-3p	CLASH	23622248
MIRT036751	hsa-miR-760	CLASH	23622248
MIRT036751	hsa-miR-760	CLASH	23622248
MIRT035936	hsa-miR-1180-3p	CLASH	23622248
MIRT035887	hsa-miR-1303	CLASH	23622248
MIRT615516	hsa-miR-605-5p	HITS-CLIP	23824327
MIRT615515	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT615514	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT615513	hsa-miR-556-3p	HITS-CLIP	23824327
MIRT615516	hsa-miR-605-5p	HITS-CLIP	23824327
MIRT615515	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT615514	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT615513	hsa-miR-556-3p	HITS-CLIP	23824327
MIRT470249	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT470248	hsa-miR-4779	PAR-CLIP	23592263
MIRT470247	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT470246	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT470245	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT470244	hsa-miR-3179	PAR-CLIP	23592263
MIRT470243	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT470242	hsa-miR-6089	PAR-CLIP	23592263
MIRT470241	hsa-miR-3202	PAR-CLIP	23592263
MIRT470240	hsa-miR-765	PAR-CLIP	23592263
MIRT470239	hsa-miR-874-5p	PAR-CLIP	23592263
MIRT470238	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT470237	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT470236	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT470235	hsa-miR-4271	PAR-CLIP	23592263
MIRT470234	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT470233	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT470232	hsa-miR-3144-5p	PAR-CLIP	23592263
MIRT470231	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT470230	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT470229	hsa-miR-5698	PAR-CLIP	23592263
MIRT470228	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT470227	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT470226	hsa-miR-4316	PAR-CLIP	23592263
MIRT439890	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439890	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT615516	hsa-miR-605-5p	HITS-CLIP	23824327
MIRT615515	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT615514	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT615513	hsa-miR-556-3p	HITS-CLIP	23824327
MIRT615516	hsa-miR-605-5p	HITS-CLIP	23824327
MIRT615515	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT615514	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT615513	hsa-miR-556-3p	HITS-CLIP	23824327
MIRT470249	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT470248	hsa-miR-4779	PAR-CLIP	23592263
MIRT470247	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT470246	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT470245	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT470244	hsa-miR-3179	PAR-CLIP	23592263
MIRT470243	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT470242	hsa-miR-6089	PAR-CLIP	23592263
MIRT470241	hsa-miR-3202	PAR-CLIP	23592263
MIRT470240	hsa-miR-765	PAR-CLIP	23592263
MIRT470239	hsa-miR-874-5p	PAR-CLIP	23592263
MIRT470238	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT470237	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT470236	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT470235	hsa-miR-4271	PAR-CLIP	23592263
MIRT470234	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT470233	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT470232	hsa-miR-3144-5p	PAR-CLIP	23592263
MIRT470231	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT470230	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT470229	hsa-miR-5698	PAR-CLIP	23592263
MIRT470228	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT470227	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT470226	hsa-miR-4316	PAR-CLIP	23592263
MIRT1267345	hsa-miR-1915	CLIP-seq
MIRT1267346	hsa-miR-4323	CLIP-seq
MIRT1267347	hsa-miR-495	CLIP-seq
MIRT1267345	hsa-miR-1915	CLIP-seq
MIRT1267346	hsa-miR-4323	CLIP-seq
MIRT1267347	hsa-miR-495	CLIP-seq
MIRT1267347	hsa-miR-495	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	16713569, 20195357
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0016020	Component	Membrane	HDA	19946888
GO:0030154	Process	Cell differentiation	IBA
GO:0070062	Component	Extracellular exosome	HDA	19056867

Other IDs

• MIM: 142580
• HGNC: 13918
• e!Ensembl: ENSG00000204469

Protein

• UniProt ID: P48634
• Protein name: Protein PRRC2A (HLA-B-associated transcript 2) (Large proline-rich protein BAT2) (Proline-rich and coiled-coil-containing protein 2A) (Protein G2)
• Protein function: May play a role in the regulation of pre-mRNA splicing.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07001	BAT2_N	1 → 189	BAT2 N-terminus	Family

• Tissue specificity: TISSUE SPECIFICITY: Limited to cell-lines of leukemic origin.
• Sequence:

  MSDRSGPTAKGKDGKKYSSLNLFDTYKGKSLEIQKPAVAPRHGLQSLGKVAIARRMPPPA
  NLPSLKAENKGNDPNVSLVPKDGTGWASKQEQSDPKSSDASTAQPPESQPLPASQTPASN
  QPKRPPAAPENTPLVPSGVKSWAQASVTHGAHGDGGRASSLLSRFSREEFPTLQAAGDQD
  KAAKERESAEQSSGPGPSLRPQNSTTWRDGGGRGPDELEGPDSKLHHGHDPRGGLQPSGP
  PQFPPYRGMMPPFMYPPYLPFPPPYGPQGPYRYPTPDGPSRFPRVAGPRGSGPPMRLVEP
  VGRPSILKEDNLKEFDQLDQENDDGWAGAHEEVDYTEKLKFSDEEDGRDSDEEGAEGHRD
  SQSASGEERPPEADGKKGNSPNSEPPTPKTAWAETSRPPETEPGPPAPKPPLPPPHRGPA
  GNWGPPGDYPDRGGPPCKPPAPEDEDEAWRQRRKQSSSEISLAVERARRRREEEERRMQE
  ERRAACAEKLKRLDEKFGAPDKRLKAEPAAPPAAPSTPAPPPAVPKELPAPPAPPPASAP
  TPETEPEEPAQAPPAQSTPTPGVAAAPTLVSGGGSTSSTSSGSFEASPVEPQLPSKEGPE
  PPEEVPPPTTPPVPKVEPKGDGIGPTRQPPSQGLGYPKYQKSLPPRFQRQQQEQLLKQQQ
  QHQWQQHQQGSAPPTPVPPSPPQPVTLGAVPAPQAPPPPPKALYPGALGRPPPMPPMNFD
  PRWMMIPPYVDPRLLQGRPPLDFYPPGVHPSGLVPRERSDSGGSSSEPFDRHAPAMLRER
  GTPPVDPKLAWVGDVFTATPAEPRPLTSPLRQAADEDDKGMRSETPPVPPPPPYLASYPG
  FPENGAPGPPISRFPLEEPGPRPLPWPPGSDEVAKIQTPPPKKEPPKEETAQLTGPEAGR
  KPARGVGSGGQGPPPPRRESRTETRWGPRPGSSRRGIPPEEPGAPPRRAGPIKKPPPPTK
  VEELPPKPLEQGDETPKPPKPDPLKITKGKLGGPKETPPNGNLSPAPRLRRDYSYERVGP
  TSCRGRGRGEYFARGRGFRGTYGGRGRGARSREFRSYREFRGDDGRGGGTGGPNHPPAPR
  GRTASETRSEGSEYEEIPKRRRQRGSETGSETHESDLAPSDKEAPTPKEGTLTQVPLAPP
  PPGAPPSPAPARFTARGGRVFTPRGVPSRRGRGGGRPPPQVCPGWSPPAKSLAPKKPPTG
  PLPPSKEPLKEKLIPGPLSPVARGGSNGGSNVGMEDGERPRRRRHGRAQQQDKPPRFRRL
  KQERENAARGSEGKPSLTLPASAPGPEEALTTVTVAPAPRRAAAKSPDLSNQNSDQANEE
  WETASESSDFTSERRGDKEAPPPVLLTPKAVGTPGGGGGGAVPGISAMSRGDLSQRAKDL
  SKRSFSSQRPGMERQNRRPGPGGKAGSSGSSSGGGGGGPGGRTGPGRGDKRSWPSPKNRS
  RPPEERPPGLPLPPPPPSSSAVFRLDQVIHSNPAGIQQALAQLSSRQGSVTAPGGHPRHK
  PGLPQAPQGPSPRPPTRYEPQRVNSGLSSDPHFEEPGPMVRGVGGTPRDSAGVSPFPPKR
  RERPPRKPELLQEESLPPPHSSGFLGSKPEGPGPQAESRDTGTEALTPHIWNRLHTATSR
  KSYRPSSMEPWMEPLSPFEDVAGTEMSQSDSGVDLSGDSQVSSGPCSQRSSPDGGLKGAA
  EGPPKRPGGSSPLNAVPCEGPPGSEPPRRPPPAPHDGDRKELPREQPLPPGPIGTERSQR
  TDRGTEPGPIRPSHRPGPPVQFGTSDKDSDLRLVVGDSLKAEKELTASVTEAIPVSRDWE
  LLPSAAASAEPQSKNLDSGHCVPEPSSSGQRLYPEVFYGSAGPSSSQISGGAMDSQLHPN
  SGGFRPGTPSLHPYRSQPLYLPPGPAPPSALLSGLALKGQFLDFSTMQATELGKLPAGGV
  LYPPPSFLYSPAFCPSPLPDTSLLQVRQDLPSPSDFYSTPLQPGGQSGFLPSGAPAQQML
  LPMVDSQLPVVNFGSLPPAPPPAPPPLSLLPVGPALQPPSLAVRPPPAPATRVLPSPARP
  FPASLGRAELHPVELKPFQDYQKLSSNLGGPGSSRTPPTGRSFSGLNSRLKATPSTYSGV
  FRTQRVDLYQQASPPDALRWIPKPWERTGPPPREGPSRRAEEPGSRGDKEPGLPPPR

• Sequence length: 2157

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL APOLIPOPROTEIN B HYPOBETALIPOPROTEINEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMBRANOUS GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRRC2A-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell lung carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	35640139	Associate	★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	20626023		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23079975	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25937444	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25937444		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23221128	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34996442	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	30335004	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	28282431	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	BEFREE	19023099		★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	28540026		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	20626023	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	35784577	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	35784577	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25093408	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10987645, 15842729		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17632545		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25093408		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	30335004	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	34996442	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	GWASDB_DG	24149102		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	24338417		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30514900		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23221128, 25937444	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	25937444		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	1672123		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	24871463		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	28754791	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	23047821		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	23047821		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29662059		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25937444		★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	GWASCAT_DG	21323541		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	20626023		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	20626023	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	17660530		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	GWASDB_DG	23055271		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20616199, 23121087		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	20616199	Associate	★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	1672123		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10604236, 10949724, 9820598		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	17804836, 19503088, 21156761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	28238293		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	28540026		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	19023099	Associate	★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	GWASCAT_DG	25604533		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	23079975	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	16116311		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASDB_DG	24837172		★★☆☆☆ Found in Text Mining + Unknown/Other Associations