Gene Gene information from NCBI Gene database.
Entrez ID 79156
Gene name Pleckstrin homology and FYVE domain containing 1
Gene symbol PLEKHF1
Synonyms (NCBI Gene)
APPDLAPFPHAFIN1ZFYVE15
Chromosome 19
Chromosome location 19q12
miRNA miRNA information provided by mirtarbase database.
25
miRTarBase ID miRNA Experiments Reference
MIRT018786 hsa-miR-335-5p Microarray 18185580
MIRT043496 hsa-miR-331-3p CLASH 23622248
MIRT1241655 hsa-miR-1224-5p CLIP-seq
MIRT1241656 hsa-miR-3160-3p CLIP-seq
MIRT1241657 hsa-miR-4436a CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005764 Component Lysosome IBA
GO:0005764 Component Lysosome IDA 22115783
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
615200 20764 ENSG00000166289
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96S99
Protein name Pleckstrin homology domain-containing family F member 1 (PH domain-containing family F member 1) (Lysosome-associated apoptosis-inducing protein containing PH and FYVE domains) (Apoptosis-inducing protein) (PH and FYVE domain-containing protein 1) (Phafin
Protein function May induce apoptosis through the lysosomal-mitochondrial pathway. Translocates to the lysosome initiating the permeabilization of lysosomal membrane (LMP) and resulting in the release of CTSD and CTSL to the cytoplasm. Triggers the caspase-indep
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00169 PH 36 131 PH domain Domain
PF01363 FYVE 147 213 FYVE zinc finger Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in heart and skeletal muscle. Weakly expressed in brain, thymus, spleen, kidney, liver, small intestine, placenta and lung. {ECO:0000269|PubMed:16188880}.
Sequence
MVDHLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFND
ILVYGSIVLNKRKYRSQHIIPLEEVTLELLPETLQAKNRWMIKTAKKSFVVSAASATERQ
EWISHIEECVR
RQLRATGRPPSTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGF
VVCAECSRQRFLLPRLSPKPVRVCSLCYRELAA
QQRQEEAEEQGAGSPGQPAHLARPICG
ASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS
Sequence length 279
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
OVARIAN NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Bladder Neoplasm Bladder Neoplasm BEFREE 22502656
★☆☆☆☆
Found in Text Mining only
Blast Crisis Blast crisis Pubtator 6586202 Associate
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 22433433 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of bladder Bladder carcinoma BEFREE 22502656
★☆☆☆☆
Found in Text Mining only
Cardiomyopathy Dilated Dilated cardiomyopathy Pubtator 36056063 Associate
★☆☆☆☆
Found in Text Mining only
Cognition Disorders Cognitive disorder BEFREE 31101513
★☆☆☆☆
Found in Text Mining only
Dementia Dementia Pubtator 28600779 Associate
★☆☆☆☆
Found in Text Mining only
Impaired cognition Impaired Cognition BEFREE 31101513
★☆☆☆☆
Found in Text Mining only
Intellectual Disability Intellectual developmental disorder Pubtator 28600779 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of ovary Ovarian cancer CTD_human_DG 21397856
★☆☆☆☆
Found in Text Mining only