Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	79137
Gene name	Reticulophagy regulator family member 2
Gene symbol	RETREG2
Synonyms (NCBI Gene)	C2orf17FAM134AMAG-2
Chromosome	2
Chromosome location	2q35

Show/Hide all (23)

miRTarBase ID	miRNA	Experiments	Reference
MIRT703713	hsa-miR-15b-3p	HITS-CLIP	23313552
MIRT703712	hsa-miR-6089	HITS-CLIP	23313552
MIRT703711	hsa-miR-6134	HITS-CLIP	23313552
MIRT703710	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT703709	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT703708	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT703707	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT703706	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT703705	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT703704	hsa-miR-6769a-5p	HITS-CLIP	23313552
MIRT703703	hsa-miR-6769b-5p	HITS-CLIP	23313552
MIRT703702	hsa-miR-6748-5p	HITS-CLIP	23313552
MIRT703701	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT703700	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT703699	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT703697	hsa-miR-1262	HITS-CLIP	23313552
MIRT703698	hsa-miR-4701-3p	HITS-CLIP	23313552
MIRT703696	hsa-miR-6736-5p	HITS-CLIP	23313552
MIRT703695	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT703694	hsa-miR-3122	HITS-CLIP	23313552
MIRT703693	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT703692	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT703691	hsa-miR-6513-5p	HITS-CLIP	23313552

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21900206, 26040720
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006914	Process	Autophagy	IEA
GO:0007029	Process	Endoplasmic reticulum organization	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0030574	Process	Collagen catabolic process	IEA
GO:0061709	Process	Reticulophagy	IEA
GO:0061753	Process	Substrate localization to autophagosome	IEA
GO:0140506	Function	Endoplasmic reticulum-autophagosome adaptor activity	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q8NC44

Protein name

Reticulophagy regulator 2

Protein function

Endoplasmic reticulum (ER)-anchored autophagy regulator which exists in an inactive state under basal conditions but is activated following cellular stress (PubMed:34338405). When activated, induces ER fragmentation and mediates ER delivery into

PDB

6EWC

Family and domains

Sequence

MASGGGGGNTGAGGGPGMGLSLGLGLGLSLGMSEATSEAEEEAATAEAVGRLATTLWLRL
RGWEAVLAAAQRLLVWEKPLHSLVTAAALNGLFWLLSSSSLRPFFLLSVSLLAYFLLDLW
QPRFLPDVSASSPEEPHSDSEGAGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKR
QNPAQFCVRVCSGCAVLAVLGHYVPGIMISYIVLLSILLWPLVVYHELIQRMYTRLEPLL
MQLDYSMKAEANALHHKHDKRKRQGKNAPPGGDEPLAETESESEAELAGFSPVVDVKKTA
LALAITDSELSDEEASILESGGFSVSRATTPQLTDVSEDLDQQSLPSEPEETLSRDLGEG
EEGELAPPEDLLGRPQALSRQALDSEEEEEDVAAKETLLRLSSPLHFVNTHFNGAGSPPD
GVKCSPGGPVETLSPETVSGGLTALPGTLSPPLCLVGSDPAPSPSILPPVPQDSPQPLPA
PEEEEALTTEDFELLDQGELEQLNAELGLEPETPPKPPDAPPLGPDIHSLVQSDQEAQAV
AEP

Sequence length

543

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma of lung	Lung carcinoma	BEFREE	19212629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33504897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33504897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19212629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19212629, 29440427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	23474461		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	23474461		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

RETREG2 (reticulophagy regulator family member 2)