TRIM48 (tripartite motif containing 48)

Gene

• Entrez ID: 79097
• Gene name: Tripartite motif containing 48
• Gene symbol: TRIM48
• Synonyms (NCBI Gene): RNF101
• Chromosome: 11
• Chromosome location: 11q11

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1455061	hsa-miR-1253	CLIP-seq
MIRT1455062	hsa-miR-128	CLIP-seq
MIRT739944	hsa-miR-204	CLIP-seq
MIRT739945	hsa-miR-211	CLIP-seq
MIRT1455063	hsa-miR-27a	CLIP-seq
MIRT1455064	hsa-miR-27b	CLIP-seq
MIRT1455065	hsa-miR-3125	CLIP-seq
MIRT1455066	hsa-miR-3168	CLIP-seq
MIRT739943	hsa-miR-323b-3p	CLIP-seq
MIRT1455067	hsa-miR-3916	CLIP-seq
MIRT739948	hsa-miR-3920	CLIP-seq
MIRT1455068	hsa-miR-4251	CLIP-seq
MIRT1455069	hsa-miR-4277	CLIP-seq
MIRT1455070	hsa-miR-4329	CLIP-seq
MIRT739947	hsa-miR-4755-5p	CLIP-seq
MIRT739949	hsa-miR-4762-3p	CLIP-seq
MIRT1455071	hsa-miR-513b	CLIP-seq
MIRT739946	hsa-miR-623	CLIP-seq
MIRT1455062	hsa-miR-128	CLIP-seq
MIRT1455063	hsa-miR-27a	CLIP-seq
MIRT1455064	hsa-miR-27b	CLIP-seq
MIRT1455066	hsa-miR-3168	CLIP-seq
MIRT1455069	hsa-miR-4277	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	29186683
GO:0005829	Component	Cytosol	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0016740	Function	Transferase activity	IEA
GO:0045087	Process	Innate immune response	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q8IWZ4
• Protein name: E3 ubiquitin-protein ligase TRIM48 (EC 2.3.2.27) (RING finger protein 101) (Tripartite motif-containing protein 48)
• Protein function: E3 ubiquitin-protein ligase which promotes K48-linked polyubiquitination of protein methyltransferase PRMT1, leading to PRMT1 degradation (PubMed:29186683). This suppresses methylation of the PRMT1 substrate MAP3K5/ASK1, promoting its activation
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15227	zf-C3HC4_4	15 → 47		Domain
  PF00643	zf-B_box	88 → 129	B-box zinc finger	Domain

• Sequence:

  MNSGISQVFQRELTCPICMNYFIDPVTIDCGHSFCRPCFYLNWQDIPILTQCFECIKTIQ
  QRNLKTNIRLKKMASLARKASLWLFLSSEEQMCGIHRETKKMFCEVDRSLLCLLCSSSQE
  HRYHRHCPAEWAAEEHWEKLLKKMQSLWEKACENQRNLNVETTRISHWKAFGDILYRSES
  VLLHMPQPLNLALRAGPITGLRDRLNQF

• Sequence length: 208

Pathways

Reactome:

Interferon gamma signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Glioblastoma	Glioblastoma	BEFREE	31703057		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31703057	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31703057		★☆☆☆☆ Found in Text Mining only