Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	79090
Gene name	Trafficking protein particle complex subunit 6A
Gene symbol	TRAPPC6A
Synonyms (NCBI Gene)	TRS33
Chromosome	19
Chromosome location	19q13.32
Summary	This gene encodes a component of the trafficking protein particle complex, which tethers transport vesicles to the cis-Golgi membrane. Loss of expression of the related gene in mouse affects coat and eye pigmentation, suggesting that the encoded protein m

Show/Hide all (72)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030324	hsa-miR-26b-5p	Microarray	19088304
MIRT617112	hsa-miR-8485	HITS-CLIP	23824327
MIRT617111	hsa-miR-4461	HITS-CLIP	23824327
MIRT617109	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT617112	hsa-miR-8485	HITS-CLIP	23824327
MIRT617111	hsa-miR-4461	HITS-CLIP	23824327
MIRT617110	hsa-miR-10b-3p	HITS-CLIP	23824327
MIRT617109	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT617112	hsa-miR-8485	HITS-CLIP	23824327
MIRT617111	hsa-miR-4461	HITS-CLIP	23824327
MIRT617109	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT617112	hsa-miR-8485	HITS-CLIP	23824327
MIRT617111	hsa-miR-4461	HITS-CLIP	23824327
MIRT617110	hsa-miR-10b-3p	HITS-CLIP	23824327
MIRT617109	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT2135375	hsa-miR-1224-3p	CLIP-seq
MIRT2135376	hsa-miR-1260	CLIP-seq
MIRT2135377	hsa-miR-1260b	CLIP-seq
MIRT2135378	hsa-miR-1280	CLIP-seq
MIRT2135379	hsa-miR-140-3p	CLIP-seq
MIRT2135380	hsa-miR-3692	CLIP-seq
MIRT2356413	hsa-miR-214	CLIP-seq
MIRT2356414	hsa-miR-24	CLIP-seq
MIRT2356415	hsa-miR-3619-5p	CLIP-seq
MIRT2356416	hsa-miR-3665	CLIP-seq
MIRT2356417	hsa-miR-4291	CLIP-seq
MIRT2356418	hsa-miR-4316	CLIP-seq
MIRT2356419	hsa-miR-4519	CLIP-seq
MIRT2356420	hsa-miR-4688	CLIP-seq
MIRT2356421	hsa-miR-4710	CLIP-seq
MIRT2356422	hsa-miR-486-3p	CLIP-seq
MIRT2356423	hsa-miR-761	CLIP-seq
MIRT2356424	hsa-miR-764	CLIP-seq
MIRT2356425	hsa-miR-922	CLIP-seq
MIRT2650031	hsa-miR-1200	CLIP-seq
MIRT2650032	hsa-miR-1207-3p	CLIP-seq
MIRT2135375	hsa-miR-1224-3p	CLIP-seq
MIRT2135376	hsa-miR-1260	CLIP-seq
MIRT2135377	hsa-miR-1260b	CLIP-seq
MIRT2135378	hsa-miR-1280	CLIP-seq
MIRT2650033	hsa-miR-1296	CLIP-seq
MIRT2135379	hsa-miR-140-3p	CLIP-seq
MIRT2650034	hsa-miR-1910	CLIP-seq
MIRT2650035	hsa-miR-1976	CLIP-seq
MIRT2356413	hsa-miR-214	CLIP-seq
MIRT2356414	hsa-miR-24	CLIP-seq
MIRT2650036	hsa-miR-2861	CLIP-seq
MIRT2356415	hsa-miR-3619-5p	CLIP-seq
MIRT2356417	hsa-miR-4291	CLIP-seq
MIRT2356418	hsa-miR-4316	CLIP-seq
MIRT2650037	hsa-miR-4324	CLIP-seq
MIRT2650038	hsa-miR-4501	CLIP-seq
MIRT2650039	hsa-miR-4512	CLIP-seq
MIRT2356419	hsa-miR-4519	CLIP-seq
MIRT2650040	hsa-miR-4649-3p	CLIP-seq
MIRT2356420	hsa-miR-4688	CLIP-seq
MIRT2356421	hsa-miR-4710	CLIP-seq
MIRT2650041	hsa-miR-4758-3p	CLIP-seq
MIRT2356422	hsa-miR-486-3p	CLIP-seq
MIRT2650042	hsa-miR-544b	CLIP-seq
MIRT2650043	hsa-miR-661	CLIP-seq
MIRT2356423	hsa-miR-761	CLIP-seq
MIRT2356425	hsa-miR-922	CLIP-seq
MIRT2650031	hsa-miR-1200	CLIP-seq
MIRT2135375	hsa-miR-1224-3p	CLIP-seq
MIRT2650033	hsa-miR-1296	CLIP-seq
MIRT2650036	hsa-miR-2861	CLIP-seq
MIRT2650037	hsa-miR-4324	CLIP-seq
MIRT2650038	hsa-miR-4501	CLIP-seq
MIRT2650039	hsa-miR-4512	CLIP-seq
MIRT2650042	hsa-miR-544b	CLIP-seq
MIRT2650043	hsa-miR-661	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 16828797, 18930054, 21273506, 23088713, 25416956, 31515488, 32296183
GO:0005737	Component	Cytoplasm	NAS	27066478
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005801	Component	Cis-Golgi network	IBA
GO:0005802	Component	Trans-Golgi network	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IBA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	NAS	27066478
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0030008	Component	TRAPP complex	IBA
GO:0048193	Process	Golgi vesicle transport	IEA
GO:0048208	Process	COPII vesicle coating	NAS	27066478
GO:0099022	Process	Vesicle tethering	NAS	27066478
GO:1990072	Component	TRAPPIII protein complex	NAS	27066478

MIM	HGNC	e!Ensembl
610396	23069	ENSG00000007255

O75865

Protein name

Trafficking protein particle complex subunit 6A (TRAPP complex subunit 6A)

Protein function

May play a role in vesicular transport during the biogenesis of melanosomes.

PDB

2C0J , 2J3T

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04051	TRAPP	7 → 157	Transport protein particle (TRAPP) component	Family

Sequence

MADTVLFEFLHTEMVAELWAHDPDPGPGGQKMSLSVLEGMGFRVGQALGERLPRETLAFR
EELDVLKFLCKDLWVAVFQKQMDSLRTNHQGTYVLQDNSFPLLLPMASGLQYLEEAPKFL
AFTCGLLRGALYTLGIESVVTASVAALPVCKFQVVIPKS

Sequence length

159

Interactions

View interactions

	Reactome
			COPII-mediated vesicle transport RAB GEFs exchange GTP for GDP on RABs

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRAPPC6A-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Congenital Abnormalities	Congenital abnormalities	Pubtator	29391579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	BEFREE	29391579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	GENOMICS_ENGLAND_DG	29391579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	29391579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	29391579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TRAPPC6A (trafficking protein particle complex subunit 6A)