Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	79075
Gene name	DNA replication and sister chromatid cohesion 1
Gene symbol	DSCC1
Synonyms (NCBI Gene)	DCC1
Chromosome	8
Chromosome location	8q24.12
Summary	CHTF18 (MIM 613201), CHTF8 (MIM 613202), and DSCC1 are components of an alternative replication factor C (RFC) (see MIM 600404) complex that loads PCNA (MIM 176740) onto DNA during S phase of the cell cycle (Merkle et al., 2003 [PubMed 12766176]; Bermudez

Show/Hide all (73)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016470	hsa-miR-193b-3p	Microarray	20304954
MIRT029497	hsa-miR-26b-5p	Microarray	19088304
MIRT442142	hsa-miR-3163	PAR-CLIP	22100165
MIRT442142	hsa-miR-3163	PAR-CLIP	22100165
MIRT442142	hsa-miR-3163	PAR-CLIP	22100165
MIRT442142	hsa-miR-3163	PAR-CLIP	22100165
MIRT945661	hsa-miR-1236	CLIP-seq
MIRT945662	hsa-miR-1244	CLIP-seq
MIRT945663	hsa-miR-132	CLIP-seq
MIRT945664	hsa-miR-142-5p	CLIP-seq
MIRT945665	hsa-miR-145	CLIP-seq
MIRT945666	hsa-miR-199a-3p	CLIP-seq
MIRT945667	hsa-miR-199b-3p	CLIP-seq
MIRT945668	hsa-miR-2115	CLIP-seq
MIRT945669	hsa-miR-2117	CLIP-seq
MIRT945670	hsa-miR-212	CLIP-seq
MIRT945671	hsa-miR-29a	CLIP-seq
MIRT945672	hsa-miR-29b	CLIP-seq
MIRT945673	hsa-miR-29c	CLIP-seq
MIRT945674	hsa-miR-30a	CLIP-seq
MIRT945675	hsa-miR-30b	CLIP-seq
MIRT945676	hsa-miR-30c	CLIP-seq
MIRT945677	hsa-miR-30d	CLIP-seq
MIRT945678	hsa-miR-30e	CLIP-seq
MIRT945679	hsa-miR-3121-3p	CLIP-seq
MIRT945680	hsa-miR-3129-5p	CLIP-seq
MIRT945681	hsa-miR-3134	CLIP-seq
MIRT945682	hsa-miR-3140-5p	CLIP-seq
MIRT945683	hsa-miR-3150b-3p	CLIP-seq
MIRT945684	hsa-miR-3157-5p	CLIP-seq
MIRT945685	hsa-miR-3168	CLIP-seq
MIRT945686	hsa-miR-3185	CLIP-seq
MIRT945687	hsa-miR-3188	CLIP-seq
MIRT945688	hsa-miR-3201	CLIP-seq
MIRT945689	hsa-miR-338-3p	CLIP-seq
MIRT945690	hsa-miR-340	CLIP-seq
MIRT945691	hsa-miR-3653	CLIP-seq
MIRT945692	hsa-miR-3658	CLIP-seq
MIRT945693	hsa-miR-4422	CLIP-seq
MIRT945694	hsa-miR-4426	CLIP-seq
MIRT945695	hsa-miR-4495	CLIP-seq
MIRT945696	hsa-miR-4530	CLIP-seq
MIRT945697	hsa-miR-4647	CLIP-seq
MIRT945698	hsa-miR-4662b	CLIP-seq
MIRT945699	hsa-miR-4689	CLIP-seq
MIRT945700	hsa-miR-4691-3p	CLIP-seq
MIRT945701	hsa-miR-4698	CLIP-seq
MIRT945702	hsa-miR-4720-3p	CLIP-seq
MIRT945703	hsa-miR-4738-3p	CLIP-seq
MIRT945704	hsa-miR-4753-3p	CLIP-seq
MIRT945705	hsa-miR-4764-5p	CLIP-seq
MIRT945706	hsa-miR-4784	CLIP-seq
MIRT945707	hsa-miR-4791	CLIP-seq
MIRT945708	hsa-miR-4804-3p	CLIP-seq
MIRT945709	hsa-miR-490-5p	CLIP-seq
MIRT945710	hsa-miR-607	CLIP-seq
MIRT945711	hsa-miR-627	CLIP-seq
MIRT945712	hsa-miR-891b	CLIP-seq
MIRT945713	hsa-miR-944	CLIP-seq
MIRT1979930	hsa-miR-3143	CLIP-seq
MIRT1979931	hsa-miR-543	CLIP-seq
MIRT2215203	hsa-miR-2467-3p	CLIP-seq
MIRT945684	hsa-miR-3157-5p	CLIP-seq
MIRT2215204	hsa-miR-3618	CLIP-seq
MIRT2215205	hsa-miR-4514	CLIP-seq
MIRT2215206	hsa-miR-4645-5p	CLIP-seq
MIRT2215207	hsa-miR-4673	CLIP-seq
MIRT945700	hsa-miR-4691-3p	CLIP-seq
MIRT2215208	hsa-miR-4692	CLIP-seq
MIRT2215209	hsa-miR-4755-3p	CLIP-seq
MIRT945712	hsa-miR-891b	CLIP-seq
MIRT2215210	hsa-miR-934	CLIP-seq
MIRT945713	hsa-miR-944	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000775	Component	Chromosome, centromeric region	IBA
GO:0000775	Component	Chromosome, centromeric region	IDA	16682347
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	IDA	16682347, 19907496
GO:0003677	Function	DNA binding	IEA
GO:0003689	Function	DNA clamp loader activity	IDA	12930902
GO:0005515	Function	Protein binding	IPI	16682347, 18499658, 28514442, 32814053, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	16682347
GO:0005654	Component	Nucleoplasm	TAS
GO:0006260	Process	DNA replication	IEA
GO:0006275	Process	Regulation of DNA replication	IMP	19907496
GO:0007064	Process	Mitotic sister chromatid cohesion	IEA
GO:0017116	Function	Single-stranded DNA helicase activity	IDA	12930902
GO:0031390	Component	Ctf18 RFC-like complex	IBA
GO:0031390	Component	Ctf18 RFC-like complex	IDA	12930902
GO:0031390	Component	Ctf18 RFC-like complex	IEA
GO:0034088	Process	Maintenance of mitotic sister chromatid cohesion	IBA
GO:0034088	Process	Maintenance of mitotic sister chromatid cohesion	IMP	16682347, 19907496
GO:0034421	Process	Post-translational protein acetylation	IMP	19907496
GO:1900264	Process	Positive regulation of DNA-directed DNA polymerase activity	IDA	12930902

MIM	HGNC	e!Ensembl
613203	24453	ENSG00000136982

Q9BVC3

Protein name

Sister chromatid cohesion protein DCC1 (Defective in sister chromatid cohesion protein 1 homolog)

Protein function

Loads PCNA onto primed templates regulating velocity, spacing and restart activity of replication forks. May couple DNA replication to sister chromatid cohesion through regulation of the acetylation of the cohesin subunit SMC3. {ECO:0000269|PubM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09724	Dcc1	43 → 357	Sister chromatid cohesion protein Dcc1	Family

Sequence

MKRTRDEVDATLQIAKLNAAELLPAVHCLGFGPGASGAAAGDFCLLELEPTLCQQLEDGH
SLVIRGDKDEQAVLCSKDKTYDLKIADTSNMLLFIPGCKTPDQLKKEDSHCNIIHTEIFG
FSNNYWELRRRRPKLKKLKKLLMENPYEGPDSQKEKDSNSSKYTTEDLLDQIQASEEEIM
TQLQVLNACKIGGYWRILEFDYEMKLLNHVTQLVDSESWSFGKVPLNTCLQELGPLEPEE
MIEHCLKCYGKKYVDEGEVYFELDADKICRAAARMLLQNAVKFNLAEFQEVWQQSVPEGM
VTSLDQLKGLALVDRHSRPEIIFLLKVDDLPEDNQERFNSLFSLREKWTEEDIAPYIQDL
CGEKQTIGALLTKYSHSSMQNGVKVYNSRRPIS

Sequence length

393

Interactions

View interactions

	Reactome
			Polymerase switching on the C-strand of the telomere

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	17925008, 33184243, 33313822, 39768811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30511685	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30511685	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31762824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24465681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19125701, 24465681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	24465681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30511685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24465681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31762824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	37904396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18498268, 30511685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23251412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	40117291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	29909703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	37244148	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	37904396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37904396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DSCC1 (DNA replication and sister chromatid cohesion 1)