Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	79068
Gene name	FTO alpha-ketoglutarate dependent dioxygenase
Gene symbol	FTO
Synonyms (NCBI Gene)	ALKBH9BMIQ14GDFDIFEX9
Chromosome	16
Chromosome location	16q12.2
Summary	This gene is a nuclear protein of the AlkB related non-haem iron and 2-oxoglutarate-dependent oxygenase superfamily but the exact physiological function of this gene is not known. Other non-heme iron enzymes function to reverse alkylated DNA and RNA damag

Show/Hide all (4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1421085	T>C	Risk-factor	Intron variant
rs121918214	G>A	Pathogenic	Genic downstream transcript variant, intron variant, coding sequence variant, missense variant, non coding transcript variant
rs781028867	C>A,T	Pathogenic	Genic downstream transcript variant, missense variant, non coding transcript variant, coding sequence variant, intron variant
rs1410999299	A>G	Likely-pathogenic	5 prime UTR variant, intron variant, missense variant, non coding transcript variant, coding sequence variant

584

Show/Hide all (584)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052254	hsa-let-7b-5p	CLASH	23622248
MIRT703462	hsa-miR-4695-5p	HITS-CLIP	23313552
MIRT703461	hsa-miR-4779	HITS-CLIP	23313552
MIRT703460	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT703459	hsa-miR-8060	HITS-CLIP	23313552
MIRT703458	hsa-miR-1225-3p	HITS-CLIP	23313552
MIRT703457	hsa-miR-1233-3p	HITS-CLIP	23313552
MIRT703456	hsa-miR-4641	HITS-CLIP	23313552
MIRT703455	hsa-miR-4266	HITS-CLIP	23313552
MIRT703454	hsa-miR-6807-5p	HITS-CLIP	23313552
MIRT508499	hsa-miR-4738-5p	PAR-CLIP	23446348
MIRT514914	hsa-miR-6134	PAR-CLIP	23446348
MIRT508498	hsa-miR-6878-5p	PAR-CLIP	23446348
MIRT508497	hsa-miR-6731-5p	PAR-CLIP	23446348
MIRT508496	hsa-miR-8085	PAR-CLIP	23446348
MIRT508495	hsa-miR-7977	PAR-CLIP	23446348
MIRT508494	hsa-miR-30c-1-3p	PAR-CLIP	23446348
MIRT508493	hsa-miR-30c-2-3p	PAR-CLIP	23446348
MIRT508492	hsa-miR-6788-5p	PAR-CLIP	23446348
MIRT508491	hsa-miR-1273h-5p	PAR-CLIP	23446348
MIRT508490	hsa-miR-30b-3p	PAR-CLIP	23446348
MIRT508489	hsa-miR-3689a-3p	PAR-CLIP	23446348
MIRT508488	hsa-miR-3689b-3p	PAR-CLIP	23446348
MIRT508487	hsa-miR-3689c	PAR-CLIP	23446348
MIRT508485	hsa-miR-6779-5p	PAR-CLIP	23446348
MIRT508486	hsa-miR-6780a-5p	PAR-CLIP	23446348
MIRT508484	hsa-miR-450a-1-3p	PAR-CLIP	23446348
MIRT508483	hsa-miR-3122	PAR-CLIP	23446348
MIRT508482	hsa-miR-3913-5p	PAR-CLIP	23446348
MIRT508481	hsa-miR-887-5p	PAR-CLIP	23446348
MIRT508480	hsa-miR-6513-5p	PAR-CLIP	23446348
MIRT508499	hsa-miR-4738-5p	PAR-CLIP	23446348
MIRT508498	hsa-miR-6878-5p	PAR-CLIP	23446348
MIRT508497	hsa-miR-6731-5p	PAR-CLIP	23446348
MIRT508496	hsa-miR-8085	PAR-CLIP	23446348
MIRT508495	hsa-miR-7977	PAR-CLIP	23446348
MIRT508494	hsa-miR-30c-1-3p	PAR-CLIP	23446348
MIRT508493	hsa-miR-30c-2-3p	PAR-CLIP	23446348
MIRT508492	hsa-miR-6788-5p	PAR-CLIP	23446348
MIRT508491	hsa-miR-1273h-5p	PAR-CLIP	23446348
MIRT508490	hsa-miR-30b-3p	PAR-CLIP	23446348
MIRT508489	hsa-miR-3689a-3p	PAR-CLIP	23446348
MIRT508488	hsa-miR-3689b-3p	PAR-CLIP	23446348
MIRT508487	hsa-miR-3689c	PAR-CLIP	23446348
MIRT508485	hsa-miR-6779-5p	PAR-CLIP	23446348
MIRT508486	hsa-miR-6780a-5p	PAR-CLIP	23446348
MIRT508484	hsa-miR-450a-1-3p	PAR-CLIP	23446348
MIRT508483	hsa-miR-3122	PAR-CLIP	23446348
MIRT508482	hsa-miR-3913-5p	PAR-CLIP	23446348
MIRT508481	hsa-miR-887-5p	PAR-CLIP	23446348
MIRT508480	hsa-miR-6513-5p	PAR-CLIP	23446348
MIRT736955	hsa-miR-607	Luciferase reporter assayWestern blottingqRT-PCR	33879631
MIRT703462	hsa-miR-4695-5p	HITS-CLIP	23313552
MIRT703461	hsa-miR-4779	HITS-CLIP	23313552
MIRT703460	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT703459	hsa-miR-8060	HITS-CLIP	23313552
MIRT703458	hsa-miR-1225-3p	HITS-CLIP	23313552
MIRT703457	hsa-miR-1233-3p	HITS-CLIP	23313552
MIRT703456	hsa-miR-4641	HITS-CLIP	23313552
MIRT703455	hsa-miR-4266	HITS-CLIP	23313552
MIRT703454	hsa-miR-6807-5p	HITS-CLIP	23313552
MIRT508499	hsa-miR-4738-5p	PAR-CLIP	23446348
MIRT514914	hsa-miR-6134	PAR-CLIP	23446348
MIRT508498	hsa-miR-6878-5p	PAR-CLIP	23446348
MIRT508497	hsa-miR-6731-5p	PAR-CLIP	23446348
MIRT508496	hsa-miR-8085	PAR-CLIP	23446348
MIRT508495	hsa-miR-7977	PAR-CLIP	23446348
MIRT508494	hsa-miR-30c-1-3p	PAR-CLIP	23446348
MIRT508493	hsa-miR-30c-2-3p	PAR-CLIP	23446348
MIRT508492	hsa-miR-6788-5p	PAR-CLIP	23446348
MIRT508491	hsa-miR-1273h-5p	PAR-CLIP	23446348
MIRT508490	hsa-miR-30b-3p	PAR-CLIP	23446348
MIRT508489	hsa-miR-3689a-3p	PAR-CLIP	23446348
MIRT508488	hsa-miR-3689b-3p	PAR-CLIP	23446348
MIRT508487	hsa-miR-3689c	PAR-CLIP	23446348
MIRT508485	hsa-miR-6779-5p	PAR-CLIP	23446348
MIRT508486	hsa-miR-6780a-5p	PAR-CLIP	23446348
MIRT508484	hsa-miR-450a-1-3p	PAR-CLIP	23446348
MIRT508483	hsa-miR-3122	PAR-CLIP	23446348
MIRT508482	hsa-miR-3913-5p	PAR-CLIP	23446348
MIRT508481	hsa-miR-887-5p	PAR-CLIP	23446348
MIRT508480	hsa-miR-6513-5p	PAR-CLIP	23446348
MIRT508499	hsa-miR-4738-5p	PAR-CLIP	23446348
MIRT508498	hsa-miR-6878-5p	PAR-CLIP	23446348
MIRT508497	hsa-miR-6731-5p	PAR-CLIP	23446348
MIRT508496	hsa-miR-8085	PAR-CLIP	23446348
MIRT508495	hsa-miR-7977	PAR-CLIP	23446348
MIRT508494	hsa-miR-30c-1-3p	PAR-CLIP	23446348
MIRT508493	hsa-miR-30c-2-3p	PAR-CLIP	23446348
MIRT508492	hsa-miR-6788-5p	PAR-CLIP	23446348
MIRT508491	hsa-miR-1273h-5p	PAR-CLIP	23446348
MIRT508490	hsa-miR-30b-3p	PAR-CLIP	23446348
MIRT508489	hsa-miR-3689a-3p	PAR-CLIP	23446348
MIRT508488	hsa-miR-3689b-3p	PAR-CLIP	23446348
MIRT508487	hsa-miR-3689c	PAR-CLIP	23446348
MIRT508485	hsa-miR-6779-5p	PAR-CLIP	23446348
MIRT508486	hsa-miR-6780a-5p	PAR-CLIP	23446348
MIRT508484	hsa-miR-450a-1-3p	PAR-CLIP	23446348
MIRT508483	hsa-miR-3122	PAR-CLIP	23446348
MIRT508482	hsa-miR-3913-5p	PAR-CLIP	23446348
MIRT508481	hsa-miR-887-5p	PAR-CLIP	23446348
MIRT508480	hsa-miR-6513-5p	PAR-CLIP	23446348
MIRT1005692	hsa-miR-1227	CLIP-seq
MIRT1005693	hsa-miR-1251	CLIP-seq
MIRT1005694	hsa-miR-1261	CLIP-seq
MIRT1005695	hsa-miR-1272	CLIP-seq
MIRT1005696	hsa-miR-1322	CLIP-seq
MIRT1005697	hsa-miR-1323	CLIP-seq
MIRT1005698	hsa-miR-148a	CLIP-seq
MIRT1005699	hsa-miR-148b	CLIP-seq
MIRT1005700	hsa-miR-152	CLIP-seq
MIRT1005701	hsa-miR-1827	CLIP-seq
MIRT1005702	hsa-miR-185	CLIP-seq
MIRT1005703	hsa-miR-2053	CLIP-seq
MIRT1005704	hsa-miR-2114	CLIP-seq
MIRT1005705	hsa-miR-2355-5p	CLIP-seq
MIRT1005706	hsa-miR-24	CLIP-seq
MIRT1005707	hsa-miR-2467-3p	CLIP-seq
MIRT1005708	hsa-miR-2467-5p	CLIP-seq
MIRT1005709	hsa-miR-3120-5p	CLIP-seq
MIRT1005710	hsa-miR-3124-3p	CLIP-seq
MIRT1005711	hsa-miR-3152-3p	CLIP-seq
MIRT1005712	hsa-miR-3160-3p	CLIP-seq
MIRT1005713	hsa-miR-3170	CLIP-seq
MIRT1005714	hsa-miR-3188	CLIP-seq
MIRT1005715	hsa-miR-3192	CLIP-seq
MIRT1005716	hsa-miR-3201	CLIP-seq
MIRT1005717	hsa-miR-3612	CLIP-seq
MIRT1005718	hsa-miR-3613-3p	CLIP-seq
MIRT1005719	hsa-miR-3646	CLIP-seq
MIRT1005720	hsa-miR-3662	CLIP-seq
MIRT1005721	hsa-miR-3665	CLIP-seq
MIRT1005722	hsa-miR-3672	CLIP-seq
MIRT1005723	hsa-miR-3679-3p	CLIP-seq
MIRT1005724	hsa-miR-3688-3p	CLIP-seq
MIRT1005725	hsa-miR-371-5p	CLIP-seq
MIRT1005726	hsa-miR-371b-5p	CLIP-seq
MIRT1005727	hsa-miR-377	CLIP-seq
MIRT1005728	hsa-miR-3915	CLIP-seq
MIRT1005729	hsa-miR-3921	CLIP-seq
MIRT1005730	hsa-miR-3928	CLIP-seq
MIRT1005731	hsa-miR-3929	CLIP-seq
MIRT1005732	hsa-miR-3975	CLIP-seq
MIRT1005733	hsa-miR-410	CLIP-seq
MIRT1005734	hsa-miR-4252	CLIP-seq
MIRT1005735	hsa-miR-4257	CLIP-seq
MIRT1005736	hsa-miR-4264	CLIP-seq
MIRT1005737	hsa-miR-4284	CLIP-seq
MIRT1005738	hsa-miR-4293	CLIP-seq
MIRT1005739	hsa-miR-4306	CLIP-seq
MIRT1005740	hsa-miR-4307	CLIP-seq
MIRT1005741	hsa-miR-4318	CLIP-seq
MIRT1005742	hsa-miR-4419b	CLIP-seq
MIRT1005743	hsa-miR-4438	CLIP-seq
MIRT1005744	hsa-miR-4446-3p	CLIP-seq
MIRT1005745	hsa-miR-4457	CLIP-seq
MIRT1005746	hsa-miR-4478	CLIP-seq
MIRT1005747	hsa-miR-4487	CLIP-seq
MIRT1005748	hsa-miR-4489	CLIP-seq
MIRT1005749	hsa-miR-4492	CLIP-seq
MIRT1005750	hsa-miR-4496	CLIP-seq
MIRT1005751	hsa-miR-4498	CLIP-seq
MIRT1005752	hsa-miR-4505	CLIP-seq
MIRT1005753	hsa-miR-4506	CLIP-seq
MIRT1005754	hsa-miR-4517	CLIP-seq
MIRT1005755	hsa-miR-451b	CLIP-seq
MIRT1005756	hsa-miR-4634	CLIP-seq
MIRT1005757	hsa-miR-4642	CLIP-seq
MIRT1005758	hsa-miR-4644	CLIP-seq
MIRT1005759	hsa-miR-4649-3p	CLIP-seq
MIRT1005760	hsa-miR-4653-5p	CLIP-seq
MIRT1005761	hsa-miR-4688	CLIP-seq
MIRT1005762	hsa-miR-4693-5p	CLIP-seq
MIRT1005763	hsa-miR-4711-3p	CLIP-seq
MIRT1005764	hsa-miR-4721	CLIP-seq
MIRT1005765	hsa-miR-4722-5p	CLIP-seq
MIRT1005766	hsa-miR-4728-5p	CLIP-seq
MIRT1005767	hsa-miR-4730	CLIP-seq
MIRT1005768	hsa-miR-4738-3p	CLIP-seq
MIRT1005769	hsa-miR-4766-5p	CLIP-seq
MIRT1005770	hsa-miR-4789-3p	CLIP-seq
MIRT1005771	hsa-miR-4791	CLIP-seq
MIRT1005772	hsa-miR-4793-3p	CLIP-seq
MIRT1005773	hsa-miR-4797-3p	CLIP-seq
MIRT1005774	hsa-miR-485-5p	CLIP-seq
MIRT1005775	hsa-miR-488	CLIP-seq
MIRT1005776	hsa-miR-490-3p	CLIP-seq
MIRT1005777	hsa-miR-495	CLIP-seq
MIRT1005778	hsa-miR-508-5p	CLIP-seq
MIRT1005779	hsa-miR-511	CLIP-seq
MIRT1005780	hsa-miR-513b	CLIP-seq
MIRT1005781	hsa-miR-513c	CLIP-seq
MIRT1005782	hsa-miR-514b-5p	CLIP-seq
MIRT1005783	hsa-miR-520a-5p	CLIP-seq
MIRT1005784	hsa-miR-525-5p	CLIP-seq
MIRT1005785	hsa-miR-545	CLIP-seq
MIRT1005786	hsa-miR-548a-3p	CLIP-seq
MIRT1005787	hsa-miR-548e	CLIP-seq
MIRT1005788	hsa-miR-548f	CLIP-seq
MIRT1005789	hsa-miR-548o	CLIP-seq
MIRT1005790	hsa-miR-548v	CLIP-seq
MIRT1005791	hsa-miR-550a	CLIP-seq
MIRT1005792	hsa-miR-558	CLIP-seq
MIRT1005793	hsa-miR-564	CLIP-seq
MIRT1005794	hsa-miR-569	CLIP-seq
MIRT1005795	hsa-miR-576-3p	CLIP-seq
MIRT1005796	hsa-miR-593	CLIP-seq
MIRT1005797	hsa-miR-596	CLIP-seq
MIRT1005798	hsa-miR-606	CLIP-seq
MIRT1005799	hsa-miR-650	CLIP-seq
MIRT1005800	hsa-miR-657	CLIP-seq
MIRT1005801	hsa-miR-658	CLIP-seq
MIRT1005802	hsa-miR-762	CLIP-seq
MIRT1005803	hsa-miR-890	CLIP-seq
MIRT1005804	hsa-miR-892a	CLIP-seq
MIRT1005805	hsa-miR-940	CLIP-seq
MIRT1005693	hsa-miR-1251	CLIP-seq
MIRT1998041	hsa-miR-1268	CLIP-seq
MIRT1998042	hsa-miR-1268b	CLIP-seq
MIRT1998043	hsa-miR-1293	CLIP-seq
MIRT1005701	hsa-miR-1827	CLIP-seq
MIRT1005704	hsa-miR-2114	CLIP-seq
MIRT1005706	hsa-miR-24	CLIP-seq
MIRT1005707	hsa-miR-2467-3p	CLIP-seq
MIRT1005712	hsa-miR-3160-3p	CLIP-seq
MIRT1998044	hsa-miR-3165	CLIP-seq
MIRT1005715	hsa-miR-3192	CLIP-seq
MIRT1005717	hsa-miR-3612	CLIP-seq
MIRT1005728	hsa-miR-3915	CLIP-seq
MIRT1005731	hsa-miR-3929	CLIP-seq
MIRT1005734	hsa-miR-4252	CLIP-seq
MIRT1005735	hsa-miR-4257	CLIP-seq
MIRT1005737	hsa-miR-4284	CLIP-seq
MIRT1005738	hsa-miR-4293	CLIP-seq
MIRT1998045	hsa-miR-4299	CLIP-seq
MIRT1005742	hsa-miR-4419b	CLIP-seq
MIRT1005746	hsa-miR-4478	CLIP-seq
MIRT1998046	hsa-miR-4483	CLIP-seq
MIRT1998047	hsa-miR-4486	CLIP-seq
MIRT1005747	hsa-miR-4487	CLIP-seq
MIRT1005750	hsa-miR-4496	CLIP-seq
MIRT1005759	hsa-miR-4649-3p	CLIP-seq
MIRT1005765	hsa-miR-4722-5p	CLIP-seq
MIRT1005766	hsa-miR-4728-5p	CLIP-seq
MIRT1005768	hsa-miR-4738-3p	CLIP-seq
MIRT1005772	hsa-miR-4793-3p	CLIP-seq
MIRT1998048	hsa-miR-4797-5p	CLIP-seq
MIRT1005774	hsa-miR-485-5p	CLIP-seq
MIRT1005776	hsa-miR-490-3p	CLIP-seq
MIRT1998049	hsa-miR-542-3p	CLIP-seq
MIRT1998050	hsa-miR-548c-3p	CLIP-seq
MIRT1005791	hsa-miR-550a	CLIP-seq
MIRT1005792	hsa-miR-558	CLIP-seq
MIRT1005793	hsa-miR-564	CLIP-seq
MIRT1998051	hsa-miR-585	CLIP-seq
MIRT1005796	hsa-miR-593	CLIP-seq
MIRT1005797	hsa-miR-596	CLIP-seq
MIRT1005799	hsa-miR-650	CLIP-seq
MIRT1005800	hsa-miR-657	CLIP-seq
MIRT1998052	hsa-miR-759	CLIP-seq
MIRT1005803	hsa-miR-890	CLIP-seq
MIRT1005805	hsa-miR-940	CLIP-seq
MIRT1998043	hsa-miR-1293	CLIP-seq
MIRT1005701	hsa-miR-1827	CLIP-seq
MIRT1005704	hsa-miR-2114	CLIP-seq
MIRT1005706	hsa-miR-24	CLIP-seq
MIRT1005707	hsa-miR-2467-3p	CLIP-seq
MIRT2231662	hsa-miR-3117-3p	CLIP-seq
MIRT2231663	hsa-miR-3123	CLIP-seq
MIRT1005712	hsa-miR-3160-3p	CLIP-seq
MIRT1998044	hsa-miR-3165	CLIP-seq
MIRT2231664	hsa-miR-3169	CLIP-seq
MIRT1005715	hsa-miR-3192	CLIP-seq
MIRT1005717	hsa-miR-3612	CLIP-seq
MIRT2231665	hsa-miR-3925-5p	CLIP-seq
MIRT1005731	hsa-miR-3929	CLIP-seq
MIRT1005735	hsa-miR-4257	CLIP-seq
MIRT1005737	hsa-miR-4284	CLIP-seq
MIRT1005742	hsa-miR-4419b	CLIP-seq
MIRT1005746	hsa-miR-4478	CLIP-seq
MIRT1998046	hsa-miR-4483	CLIP-seq
MIRT1005747	hsa-miR-4487	CLIP-seq
MIRT1005759	hsa-miR-4649-3p	CLIP-seq
MIRT1005765	hsa-miR-4722-5p	CLIP-seq
MIRT1005766	hsa-miR-4728-5p	CLIP-seq
MIRT2231666	hsa-miR-4753-3p	CLIP-seq
MIRT2231667	hsa-miR-4759	CLIP-seq
MIRT1005774	hsa-miR-485-5p	CLIP-seq
MIRT1005776	hsa-miR-490-3p	CLIP-seq
MIRT1998050	hsa-miR-548c-3p	CLIP-seq
MIRT2231668	hsa-miR-548q	CLIP-seq
MIRT1005791	hsa-miR-550a	CLIP-seq
MIRT1005792	hsa-miR-558	CLIP-seq
MIRT1005793	hsa-miR-564	CLIP-seq
MIRT2231669	hsa-miR-583	CLIP-seq
MIRT1005799	hsa-miR-650	CLIP-seq
MIRT1005803	hsa-miR-890	CLIP-seq
MIRT1005805	hsa-miR-940	CLIP-seq
MIRT1005692	hsa-miR-1227	CLIP-seq
MIRT1005701	hsa-miR-1827	CLIP-seq
MIRT1005706	hsa-miR-24	CLIP-seq
MIRT1005707	hsa-miR-2467-3p	CLIP-seq
MIRT1005712	hsa-miR-3160-3p	CLIP-seq
MIRT1005715	hsa-miR-3192	CLIP-seq
MIRT1005717	hsa-miR-3612	CLIP-seq
MIRT1005734	hsa-miR-4252	CLIP-seq
MIRT1005735	hsa-miR-4257	CLIP-seq
MIRT1005737	hsa-miR-4284	CLIP-seq
MIRT1005747	hsa-miR-4487	CLIP-seq
MIRT1005756	hsa-miR-4634	CLIP-seq
MIRT1005766	hsa-miR-4728-5p	CLIP-seq
MIRT1005770	hsa-miR-4789-3p	CLIP-seq
MIRT1005776	hsa-miR-490-3p	CLIP-seq
MIRT1005792	hsa-miR-558	CLIP-seq
MIRT1005799	hsa-miR-650	CLIP-seq
MIRT1998047	hsa-miR-4486	CLIP-seq
MIRT1998050	hsa-miR-548c-3p	CLIP-seq
MIRT2535555	hsa-miR-1197	CLIP-seq
MIRT2535556	hsa-miR-1207-5p	CLIP-seq
MIRT1005692	hsa-miR-1227	CLIP-seq
MIRT2535557	hsa-miR-1262	CLIP-seq
MIRT1998041	hsa-miR-1268	CLIP-seq
MIRT1998042	hsa-miR-1268b	CLIP-seq
MIRT2535558	hsa-miR-138	CLIP-seq
MIRT1005698	hsa-miR-148a	CLIP-seq
MIRT1005699	hsa-miR-148b	CLIP-seq
MIRT1005700	hsa-miR-152	CLIP-seq
MIRT1005701	hsa-miR-1827	CLIP-seq
MIRT2535559	hsa-miR-183	CLIP-seq
MIRT2535560	hsa-miR-186	CLIP-seq
MIRT1005704	hsa-miR-2114	CLIP-seq
MIRT2535561	hsa-miR-217	CLIP-seq
MIRT2535562	hsa-miR-2392	CLIP-seq
MIRT1005707	hsa-miR-2467-3p	CLIP-seq
MIRT2535563	hsa-miR-3064-5p	CLIP-seq
MIRT2231662	hsa-miR-3117-3p	CLIP-seq
MIRT2535564	hsa-miR-3133	CLIP-seq
MIRT2535565	hsa-miR-3135	CLIP-seq
MIRT2535566	hsa-miR-3143	CLIP-seq
MIRT2535567	hsa-miR-3150b-3p	CLIP-seq
MIRT1005712	hsa-miR-3160-3p	CLIP-seq
MIRT2535568	hsa-miR-3166	CLIP-seq
MIRT2535569	hsa-miR-3168	CLIP-seq
MIRT2231664	hsa-miR-3169	CLIP-seq
MIRT2535570	hsa-miR-3189-5p	CLIP-seq
MIRT1005715	hsa-miR-3192	CLIP-seq
MIRT2535571	hsa-miR-335	CLIP-seq
MIRT2535572	hsa-miR-3605-5p	CLIP-seq
MIRT1005717	hsa-miR-3612	CLIP-seq
MIRT1005718	hsa-miR-3613-3p	CLIP-seq
MIRT2535573	hsa-miR-3622a-5p	CLIP-seq
MIRT1005721	hsa-miR-3665	CLIP-seq
MIRT2535574	hsa-miR-3667-3p	CLIP-seq
MIRT1005722	hsa-miR-3672	CLIP-seq
MIRT2535575	hsa-miR-3675-5p	CLIP-seq
MIRT1005725	hsa-miR-371-5p	CLIP-seq
MIRT1005726	hsa-miR-371b-5p	CLIP-seq
MIRT2535576	hsa-miR-3926	CLIP-seq
MIRT1005731	hsa-miR-3929	CLIP-seq
MIRT1005734	hsa-miR-4252	CLIP-seq
MIRT1005735	hsa-miR-4257	CLIP-seq
MIRT1005736	hsa-miR-4264	CLIP-seq
MIRT2535577	hsa-miR-4274	CLIP-seq
MIRT2535578	hsa-miR-4279	CLIP-seq
MIRT2535579	hsa-miR-4283	CLIP-seq
MIRT1998045	hsa-miR-4299	CLIP-seq
MIRT2535580	hsa-miR-4303	CLIP-seq
MIRT2535581	hsa-miR-4419a	CLIP-seq
MIRT1005742	hsa-miR-4419b	CLIP-seq
MIRT2535582	hsa-miR-4443	CLIP-seq
MIRT2535583	hsa-miR-4453	CLIP-seq
MIRT2535584	hsa-miR-4455	CLIP-seq
MIRT2535585	hsa-miR-4456	CLIP-seq
MIRT2535586	hsa-miR-4470	CLIP-seq
MIRT2535587	hsa-miR-4471	CLIP-seq
MIRT2535588	hsa-miR-4474-3p	CLIP-seq
MIRT2535589	hsa-miR-4477a	CLIP-seq
MIRT1005746	hsa-miR-4478	CLIP-seq
MIRT1998047	hsa-miR-4486	CLIP-seq
MIRT1005747	hsa-miR-4487	CLIP-seq
MIRT2535590	hsa-miR-4488	CLIP-seq
MIRT1005748	hsa-miR-4489	CLIP-seq
MIRT2535591	hsa-miR-4495	CLIP-seq
MIRT2535592	hsa-miR-4501	CLIP-seq
MIRT2535593	hsa-miR-4504	CLIP-seq
MIRT1005752	hsa-miR-4505	CLIP-seq
MIRT2535594	hsa-miR-4509	CLIP-seq
MIRT2535595	hsa-miR-4510	CLIP-seq
MIRT2535596	hsa-miR-4538	CLIP-seq
MIRT1005759	hsa-miR-4649-3p	CLIP-seq
MIRT2535597	hsa-miR-4652-3p	CLIP-seq
MIRT2535598	hsa-miR-4659a-5p	CLIP-seq
MIRT2535599	hsa-miR-4659b-5p	CLIP-seq
MIRT2535600	hsa-miR-4675	CLIP-seq
MIRT2535601	hsa-miR-4682	CLIP-seq
MIRT2535602	hsa-miR-4694-3p	CLIP-seq
MIRT2535603	hsa-miR-4697-5p	CLIP-seq
MIRT2535604	hsa-miR-4701-3p	CLIP-seq
MIRT1005763	hsa-miR-4711-3p	CLIP-seq
MIRT2535605	hsa-miR-4720-3p	CLIP-seq
MIRT1005765	hsa-miR-4722-5p	CLIP-seq
MIRT2535606	hsa-miR-4725-5p	CLIP-seq
MIRT2535607	hsa-miR-4728-3p	CLIP-seq
MIRT1005766	hsa-miR-4728-5p	CLIP-seq
MIRT2535608	hsa-miR-4736	CLIP-seq
MIRT2535609	hsa-miR-4737	CLIP-seq
MIRT2535610	hsa-miR-4741	CLIP-seq
MIRT2535611	hsa-miR-4744	CLIP-seq
MIRT2535612	hsa-miR-4747-5p	CLIP-seq
MIRT2231666	hsa-miR-4753-3p	CLIP-seq
MIRT2535613	hsa-miR-4758-3p	CLIP-seq
MIRT2231667	hsa-miR-4759	CLIP-seq
MIRT2535614	hsa-miR-4763-3p	CLIP-seq
MIRT2535615	hsa-miR-4769-3p	CLIP-seq
MIRT2535616	hsa-miR-4771	CLIP-seq
MIRT2535617	hsa-miR-4775	CLIP-seq
MIRT2535618	hsa-miR-4784	CLIP-seq
MIRT2535619	hsa-miR-4786-5p	CLIP-seq
MIRT2535620	hsa-miR-4793-5p	CLIP-seq
MIRT1005773	hsa-miR-4797-3p	CLIP-seq
MIRT1998048	hsa-miR-4797-5p	CLIP-seq
MIRT2535621	hsa-miR-4799-5p	CLIP-seq
MIRT2535622	hsa-miR-4804-3p	CLIP-seq
MIRT1005774	hsa-miR-485-5p	CLIP-seq
MIRT1005775	hsa-miR-488	CLIP-seq
MIRT1005776	hsa-miR-490-3p	CLIP-seq
MIRT2535623	hsa-miR-498	CLIP-seq
MIRT2535624	hsa-miR-504	CLIP-seq
MIRT1005780	hsa-miR-513b	CLIP-seq
MIRT2535625	hsa-miR-522	CLIP-seq
MIRT1998049	hsa-miR-542-3p	CLIP-seq
MIRT2535626	hsa-miR-548ae	CLIP-seq
MIRT2535627	hsa-miR-548aj	CLIP-seq
MIRT2535628	hsa-miR-548am	CLIP-seq
MIRT1998050	hsa-miR-548c-3p	CLIP-seq
MIRT2231668	hsa-miR-548q	CLIP-seq
MIRT2535629	hsa-miR-548s	CLIP-seq
MIRT2535630	hsa-miR-548u	CLIP-seq
MIRT2535631	hsa-miR-548x	CLIP-seq
MIRT2535632	hsa-miR-549	CLIP-seq
MIRT1005791	hsa-miR-550a	CLIP-seq
MIRT1005792	hsa-miR-558	CLIP-seq
MIRT1005793	hsa-miR-564	CLIP-seq
MIRT2231669	hsa-miR-583	CLIP-seq
MIRT1998051	hsa-miR-585	CLIP-seq
MIRT1005796	hsa-miR-593	CLIP-seq
MIRT2535633	hsa-miR-600	CLIP-seq
MIRT2535634	hsa-miR-604	CLIP-seq
MIRT2535635	hsa-miR-609	CLIP-seq
MIRT2535636	hsa-miR-647	CLIP-seq
MIRT1005799	hsa-miR-650	CLIP-seq
MIRT1005800	hsa-miR-657	CLIP-seq
MIRT1998052	hsa-miR-759	CLIP-seq
MIRT2535637	hsa-miR-765	CLIP-seq
MIRT1005803	hsa-miR-890	CLIP-seq
MIRT1005804	hsa-miR-892a	CLIP-seq
MIRT1005805	hsa-miR-940	CLIP-seq
MIRT2535638	hsa-miR-944	CLIP-seq
MIRT2535556	hsa-miR-1207-5p	CLIP-seq
MIRT2535557	hsa-miR-1262	CLIP-seq
MIRT1998041	hsa-miR-1268	CLIP-seq
MIRT1998042	hsa-miR-1268b	CLIP-seq
MIRT2535558	hsa-miR-138	CLIP-seq
MIRT1005698	hsa-miR-148a	CLIP-seq
MIRT1005699	hsa-miR-148b	CLIP-seq
MIRT1005700	hsa-miR-152	CLIP-seq
MIRT1005701	hsa-miR-1827	CLIP-seq
MIRT2535559	hsa-miR-183	CLIP-seq
MIRT1005704	hsa-miR-2114	CLIP-seq
MIRT2535561	hsa-miR-217	CLIP-seq
MIRT2535562	hsa-miR-2392	CLIP-seq
MIRT1005707	hsa-miR-2467-3p	CLIP-seq
MIRT2535563	hsa-miR-3064-5p	CLIP-seq
MIRT2231662	hsa-miR-3117-3p	CLIP-seq
MIRT2535565	hsa-miR-3135	CLIP-seq
MIRT2535566	hsa-miR-3143	CLIP-seq
MIRT2535567	hsa-miR-3150b-3p	CLIP-seq
MIRT1005712	hsa-miR-3160-3p	CLIP-seq
MIRT2535568	hsa-miR-3166	CLIP-seq
MIRT2231664	hsa-miR-3169	CLIP-seq
MIRT2535570	hsa-miR-3189-5p	CLIP-seq
MIRT1005715	hsa-miR-3192	CLIP-seq
MIRT2535571	hsa-miR-335	CLIP-seq
MIRT2535572	hsa-miR-3605-5p	CLIP-seq
MIRT1005717	hsa-miR-3612	CLIP-seq
MIRT1005718	hsa-miR-3613-3p	CLIP-seq
MIRT1005721	hsa-miR-3665	CLIP-seq
MIRT1005722	hsa-miR-3672	CLIP-seq
MIRT2535575	hsa-miR-3675-5p	CLIP-seq
MIRT1005725	hsa-miR-371-5p	CLIP-seq
MIRT1005726	hsa-miR-371b-5p	CLIP-seq
MIRT2535576	hsa-miR-3926	CLIP-seq
MIRT1005731	hsa-miR-3929	CLIP-seq
MIRT1005735	hsa-miR-4257	CLIP-seq
MIRT1005736	hsa-miR-4264	CLIP-seq
MIRT2535577	hsa-miR-4274	CLIP-seq
MIRT2535578	hsa-miR-4279	CLIP-seq
MIRT2535579	hsa-miR-4283	CLIP-seq
MIRT1998045	hsa-miR-4299	CLIP-seq
MIRT2535581	hsa-miR-4419a	CLIP-seq
MIRT1005742	hsa-miR-4419b	CLIP-seq
MIRT2535582	hsa-miR-4443	CLIP-seq
MIRT2535583	hsa-miR-4453	CLIP-seq
MIRT2535585	hsa-miR-4456	CLIP-seq
MIRT2535586	hsa-miR-4470	CLIP-seq
MIRT2535587	hsa-miR-4471	CLIP-seq
MIRT2535588	hsa-miR-4474-3p	CLIP-seq
MIRT2535589	hsa-miR-4477a	CLIP-seq
MIRT1005746	hsa-miR-4478	CLIP-seq
MIRT1998047	hsa-miR-4486	CLIP-seq
MIRT1005747	hsa-miR-4487	CLIP-seq
MIRT2535590	hsa-miR-4488	CLIP-seq
MIRT1005748	hsa-miR-4489	CLIP-seq
MIRT2535591	hsa-miR-4495	CLIP-seq
MIRT2535592	hsa-miR-4501	CLIP-seq
MIRT2535593	hsa-miR-4504	CLIP-seq
MIRT1005752	hsa-miR-4505	CLIP-seq
MIRT2535595	hsa-miR-4510	CLIP-seq
MIRT2535596	hsa-miR-4538	CLIP-seq
MIRT1005759	hsa-miR-4649-3p	CLIP-seq
MIRT2535597	hsa-miR-4652-3p	CLIP-seq
MIRT2535598	hsa-miR-4659a-5p	CLIP-seq
MIRT2535599	hsa-miR-4659b-5p	CLIP-seq
MIRT2535600	hsa-miR-4675	CLIP-seq
MIRT2535602	hsa-miR-4694-3p	CLIP-seq
MIRT2535603	hsa-miR-4697-5p	CLIP-seq
MIRT2535604	hsa-miR-4701-3p	CLIP-seq
MIRT1005763	hsa-miR-4711-3p	CLIP-seq
MIRT2535605	hsa-miR-4720-3p	CLIP-seq
MIRT1005765	hsa-miR-4722-5p	CLIP-seq
MIRT2535606	hsa-miR-4725-5p	CLIP-seq
MIRT2535607	hsa-miR-4728-3p	CLIP-seq
MIRT1005766	hsa-miR-4728-5p	CLIP-seq
MIRT2535608	hsa-miR-4736	CLIP-seq
MIRT2535609	hsa-miR-4737	CLIP-seq
MIRT2535610	hsa-miR-4741	CLIP-seq
MIRT2535611	hsa-miR-4744	CLIP-seq
MIRT2535612	hsa-miR-4747-5p	CLIP-seq
MIRT2231666	hsa-miR-4753-3p	CLIP-seq
MIRT2535613	hsa-miR-4758-3p	CLIP-seq
MIRT2231667	hsa-miR-4759	CLIP-seq
MIRT2535614	hsa-miR-4763-3p	CLIP-seq
MIRT2535615	hsa-miR-4769-3p	CLIP-seq
MIRT2535616	hsa-miR-4771	CLIP-seq
MIRT2535618	hsa-miR-4784	CLIP-seq
MIRT2535619	hsa-miR-4786-5p	CLIP-seq
MIRT2535620	hsa-miR-4793-5p	CLIP-seq
MIRT1005773	hsa-miR-4797-3p	CLIP-seq
MIRT1998048	hsa-miR-4797-5p	CLIP-seq
MIRT2535622	hsa-miR-4804-3p	CLIP-seq
MIRT1005774	hsa-miR-485-5p	CLIP-seq
MIRT1005775	hsa-miR-488	CLIP-seq
MIRT1005776	hsa-miR-490-3p	CLIP-seq
MIRT2535623	hsa-miR-498	CLIP-seq
MIRT2535624	hsa-miR-504	CLIP-seq
MIRT1005780	hsa-miR-513b	CLIP-seq
MIRT2535625	hsa-miR-522	CLIP-seq
MIRT1998049	hsa-miR-542-3p	CLIP-seq
MIRT2535626	hsa-miR-548ae	CLIP-seq
MIRT2535627	hsa-miR-548aj	CLIP-seq
MIRT2535628	hsa-miR-548am	CLIP-seq
MIRT1998050	hsa-miR-548c-3p	CLIP-seq
MIRT2231668	hsa-miR-548q	CLIP-seq
MIRT2535629	hsa-miR-548s	CLIP-seq
MIRT2535630	hsa-miR-548u	CLIP-seq
MIRT2535631	hsa-miR-548x	CLIP-seq
MIRT2535632	hsa-miR-549	CLIP-seq
MIRT1005791	hsa-miR-550a	CLIP-seq
MIRT1005792	hsa-miR-558	CLIP-seq
MIRT1005793	hsa-miR-564	CLIP-seq
MIRT2231669	hsa-miR-583	CLIP-seq
MIRT1998051	hsa-miR-585	CLIP-seq
MIRT1005796	hsa-miR-593	CLIP-seq
MIRT2535634	hsa-miR-604	CLIP-seq
MIRT2535636	hsa-miR-647	CLIP-seq
MIRT1005799	hsa-miR-650	CLIP-seq
MIRT1005800	hsa-miR-657	CLIP-seq
MIRT1998052	hsa-miR-759	CLIP-seq
MIRT2535637	hsa-miR-765	CLIP-seq
MIRT2681222	hsa-miR-769-5p	CLIP-seq
MIRT1005803	hsa-miR-890	CLIP-seq
MIRT1005804	hsa-miR-892a	CLIP-seq
MIRT1005805	hsa-miR-940	CLIP-seq
MIRT2535638	hsa-miR-944	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
CUX1	Unknown	23341774

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001659	Process	Temperature homeostasis	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	26458103, 28002401, 30197295
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS	17991826
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	28002401
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006307	Process	DNA alkylation repair	IBA
GO:0006307	Process	DNA alkylation repair	IDA	18775698
GO:0006307	Process	DNA alkylation repair	IEA
GO:0008198	Function	Ferrous iron binding	IDA	20376003
GO:0010883	Process	Regulation of lipid storage	IBA
GO:0010883	Process	Regulation of lipid storage	IEA
GO:0010883	Process	Regulation of lipid storage	IMP	26287746
GO:0016180	Process	SnRNA processing	IDA	30197295
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016607	Component	Nuclear speck	IDA	22002720
GO:0016607	Component	Nuclear speck	IEA
GO:0016706	Function	2-oxoglutarate-dependent dioxygenase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0035515	Function	Oxidative RNA demethylase activity	IDA	18775698, 22002720, 28002401, 30197295
GO:0035515	Function	Oxidative RNA demethylase activity	IEA
GO:0035516	Function	Broad specificity oxidative DNA demethylase activity	IBA
GO:0035516	Function	Broad specificity oxidative DNA demethylase activity	IDA	18775698, 20376003
GO:0035516	Function	Broad specificity oxidative DNA demethylase activity	IEA
GO:0040014	Process	Regulation of multicellular organism growth	IEA
GO:0042245	Process	RNA repair	IBA
GO:0042245	Process	RNA repair	IDA	18775698
GO:0042245	Process	RNA repair	IEA
GO:0044065	Process	Regulation of respiratory system process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051213	Function	Dioxygenase activity	IEA
GO:0060612	Process	Adipose tissue development	IEA
GO:0061157	Process	MRNA destabilization	IDA	28002401, 30197295
GO:0070350	Process	Regulation of white fat cell proliferation	IEA
GO:0090335	Process	Regulation of brown fat cell differentiation	IMP	26287746
GO:1990931	Function	MRNA N6-methyladenosine dioxygenase activity	IBA
GO:1990931	Function	MRNA N6-methyladenosine dioxygenase activity	IDA	25452335, 26457839, 30197295
GO:1990931	Function	MRNA N6-methyladenosine dioxygenase activity	IEA
GO:1990931	Function	MRNA N6-methyladenosine dioxygenase activity	IMP	26458103
GO:1990984	Function	TRNA demethylase activity	IDA	30197295

MIM	HGNC	e!Ensembl
610966	24678	ENSG00000140718

Q9C0B1

Protein name

Alpha-ketoglutarate-dependent dioxygenase FTO (Fat mass and obesity-associated protein) (U6 small nuclear RNA (2'-O-methyladenosine-N(6)-)-demethylase FTO) (EC 1.14.11.-) (U6 small nuclear RNA N(6)-methyladenosine-demethylase FTO) (EC 1.14.11.-) (mRNA (2'

Protein function

RNA demethylase that mediates oxidative demethylation of different RNA species, such as mRNAs, tRNAs and snRNAs, and acts as a regulator of fat mass, adipogenesis and energy homeostasis (PubMed:22002720, PubMed:25452335, PubMed:26457839, PubMed:

PDB

3LFM , 4CXW , 4CXX , 4CXY , 4IDZ , 4IE0 , 4IE4 , 4IE5 , 4IE6 , 4IE7 , 4QHO , 4QKN , 4ZS2 , 4ZS3 , 5DAB , 5F8P , 5ZMD , 6AEJ , 6AK4 , 6AKW , 7CKK , 7E8Z , 7WCV , 8IT9 , 9KNI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12933	FTO_NTD	36 → 325	FTO catalytic domain	Domain
PF12934	FTO_CTD	329 → 498	FTO C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed, with relatively high expression in adrenal glands and brain; especially in hypothalamus and pituitary (PubMed:17434869, PubMed:17496892). Highly expressed in highly expressed in acute myeloid leukemias (AML) wit

Sequence

MKRTPTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLILREASSVSEE
LHKEVQEAFLTLHKHGCLFRDLVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPV
KGSNIKHTEAEIAAACETFLKLNDYLQIETIQALEELAAKEKANEDAVPLCMSADFPRVG
MGSSYNGQDEVDIKSRAAYNVTLLNFMDPQKMPYLKEEPYFGMGKMAVSWHHDENLVDRS
AVAVYSYSCEGPEEESEDDSHLEGRDPDIWHVGFKISWDIETPGLAIPLHQGDCYFMLDD
LNATHQHCVLAGSQPRFSSTHRVAECSTGTLDYILQRCQLALQNVCDDVDNDDVSLKSFE
PAVLKQGEEIHNEVEFEWLRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGVTNAVLHE
VKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDD
ASMPLPFDLTDIVSELRGQLLEAKP

Sequence length

505

Interactions

View interactions

	Reactome
			Reversal of alkylation damage by DNA dioxygenases

113

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Body mass index quantitative trait locus 14	Likely pathogenic	rs2078991144	RCV003990737	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lethal polymalformative syndrome, Boissel type	Likely pathogenic; Pathogenic	rs121918214, rs781028867	RCV000001110 RCV000190415	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (111)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE DISEASE 2	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FLUTTER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BODY WEIGHT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARPAL TUNNEL SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC VENOUS INSUFFICIENCY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOMYCOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOPHYTOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC EYE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC POLYNEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIASTOLIC HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FTO-related disorder	Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GROWTH RETARDATION, DEVELOPMENTAL DELAY, AND FACIAL DYSMORPHISM	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GROWTH RETARDATION, DEVELOPMENTAL DELAY, COARSE FACIES, AND EARLY DEATH	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, PREGNANCY-INDUCED	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE HEART DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE NEPHROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meniere disease	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MORBID OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY (BMIQ14), SUSCEPTIBILITY TO	risk factor	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL CAVITY CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOMYELITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOPENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYNOVITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES NEPHROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UROLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (327)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acromegaly	Acromegaly	BEFREE	28913579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	Pubtator	28913579, 37446150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	20362563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	22153534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	21317302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	33725886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	GWASCAT_DG	25085501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	23251365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	29216901	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	29216901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	20339516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	21438147, 22797368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia nervosa	Pubtator	22797368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	25065638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	25065638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	26431034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	26431034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	20502638, 21102551, 21593801, 23136261, 26555680, 28253220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	30733965, 35806402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30166627, 32884942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20816195, 26504195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	19587359, 20031593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	20502638, 21102551, 21593801, 23136261, 26555680, 28253220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	27790247		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	23155456, 23512716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	23512716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	26529281, 31033179		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Body Weight	Body weight	Pubtator	19828706, 21347432, 28659218, 36415696	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BORNHOLM EYE DISEASE	Bornholm Eye Disease	BEFREE	30677719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	20404173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	20404173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21489227, 23593120, 24023349, 24065098, 25007960, 25862352, 26146447, 26865587, 28377418, 28547937, 28591216, 28599470, 29220587, 30465076, 30922314, 30953473 View all (1 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	23535729, 23535733, 25751625, 27117709, 29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	23535733		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	21489227, 21688152, 23535733, 23593120, 24065098, 25862352, 26146447, 26722548, 27053251, 28377418, 32805088, 33342785, 33634577, 33785833, 34076564 View all (9 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bulimia	Bulimia	BEFREE	26193063, 30822753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	Pubtator	26193063, 28282466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	22797368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	Pubtator	22797368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21347432, 32053666, 33634966, 34087991, 35524932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35858900	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32631107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34221187	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19542184, 30905413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37914721, 40262723	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37626050, 38164857, 38270643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	37041267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	22016090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18779467, 19910641, 20400278, 21098976, 21146673, 22791637, 23254338, 23551410, 23977173, 24289790, 24622111, 25184161, 26431034, 26555680, 26772723, 26878843, 28913579 View all (2 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	19910641, 21146673, 22791637, 23551410, 24289790, 26431034, 26878843, 28913579, 32271440, 34537236, 37446150	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	Pubtator	36894991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	36894991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	19329528, 24754249		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	BEFREE	26222659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	20404173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	35705018	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27701175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31827395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31827395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	21788373, 23258813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21037115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	21037115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic schizophrenia	Schizophrenia	BEFREE	23236985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	30111348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	23136261, 29529147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27449576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22153534, 27449576, 30556861, 31396313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20339516, 30556861, 32053666, 33741917, 37543622, 39849877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital exomphalos	Congenital Exomphalos	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital genu recurvatum	Congenital genu recurvatum	BEFREE	24702222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital malformation syndrome	Congenital Malformation Syndrome	BEFREE	26378117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29997116		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30380400, 30648791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	25644180, 26878843, 27218147		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	25644180, 26878843, 27218147, 28167353		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	26878843, 28167353	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	26878843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21347282		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	25644180, 26878843, 27218147		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	27790247		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	36595818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	25407435		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cutaneous Melanoma	Melanoma	GWASCAT_DG	30429480		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cutis marmorata	Cutis marmorata	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	39260370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dandy-Walker Syndrome	Dandy-Walker Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	25161014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	22763110, 22956599, 23921993, 27696742, 29606151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	21098976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	21502950, 23164817, 25656382, 26047305, 26717541		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	21502950, 23164817, 25656382		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	25102252, 28765304	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	17434869, 18346983, 18437351, 18535549, 18541994, 18599522, 18787525, 19068149, 19329528, 19763711, 19913856, 20075932, 20337217, 20400278, 20502638 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28699988, 30371117, 31825269, 32390949, 33953693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	32390949	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17434869, 18346983, 18437351, 18535549, 18541994, 18599522, 18787525, 19068149, 19329528, 19763711, 19913856, 20075932, 20337217, 20400278, 20502638 View all (18 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	17434869, 18239580, 18346983, 18535549, 18599522, 19008344, 20161779, 20502638, 20548773, 21146673, 21266646, 21868005, 22421923, 23185617, 23236435 View all (15 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	GWASCAT_DG	27790247		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17463248, 17786212, 18335027, 18346983, 18426861, 18469204, 18487448, 18535549, 18598350, 18599522, 18694974, 18787525, 19005641, 19008344, 19056611 View all (65 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	25184161, 30099472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17434869, 17786212, 17804762, 17928989, 17942823, 17959933, 18335027, 18346983, 18437351, 18469204, 18478198, 18487448, 18572014, 18597214, 18599522 View all (99 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17463248, 17463249, 17554300, 19056611, 20581827, 21647700, 22158537, 22693455, 22885922, 23300278, 24509480		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	17463248, 17463249, 17554300, 19056611, 20581827, 22693455, 22885922, 24509480, 26818947, 26961502, 28869590, 30054458, 30595370, 30718926		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	23104008		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	39343042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	31568687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30566433, 31568687		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	29154870		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	29410390	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	23155456, 24863145, 31772290, 37223038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
dowling-degos disease	Dowling-Degos Disease	BEFREE	24304927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	24331679, 30311736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	27173266, 33348678, 38161971, 40114142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	21438147, 22797368, 28282466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	21347432, 22222214, 28849183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20647405, 21347432, 21976109, 34347888, 35731272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	36672827, 37871609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	22948233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	22948233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35524932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	23691120		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	Pubtator	23691120	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty liver	Pubtator	25367448, 28116842, 32848374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29924135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28116842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29040886, 30105001, 30465076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33412003, 39216042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29040886, 30105001, 30465076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36123877, 36718644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	26378117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	30026463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	34713923, 38064210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	GWASCAT_DG	27790247		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	29997116		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatoblastoma	Hepatoblastoma	Pubtator	35311451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	22901973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	19913856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	36183687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	22504289, 27914922, 30063936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	22504289, 29315078, 34454619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	24023349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	23490278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	21146673, 22132335, 23691120, 23824655, 23849767, 34134115, 37181702, 37697388	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	20031594, 21146673, 23111453, 23258813, 23588626, 23691120, 23849767, 24641884, 26324055		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	23990951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	31728912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34713923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36718644	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21458110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	26820768, 37871609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	27558924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31813937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	27390851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	20377915, 20858286, 21919686, 22504289, 22791637, 22791750, 24289790, 25367448, 25761503, 27759977, 29764479, 30733965, 31200723, 32495892, 34063412, 37111057, 37710301, 40055326 View all (3 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	28398475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	23944291, 24304927, 30099472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	24304927, 30099472, 34812958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	30099472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	31143705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Transient ischemic attack	Pubtator	21921652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	21788373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31578283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	31178898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Autoimmune Diabetes	BEFREE	31125083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Latent autoimmune diabetes in adults	Pubtator	31125083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	37175660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lethal polymalformative syndrome, Boissel type	Lethal Polymalformative Syndrome	Orphanet			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Leukemia	Leukemia	Pubtator	28017614, 32531268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	29040886, 30063141, 30105001, 30297871, 30575149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	28017614	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30991023, 33412003, 35311451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28017614, 30465076, 30991023, 30991027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	GWASCAT_DG	27558924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	31813937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lissencephaly	Lissencephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31632576, 9918938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	25367448, 36371078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	9918938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	32685056	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32805088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macroglossia	Macroglossia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	21502950, 23933215, 24809401, 26047305, 26766031		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	29675043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant melanoma of skin of lower limb	Malignant melanoma of skin	GWASCAT_DG	30429480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant melanoma of skin of upper limb	Malignant melanoma of skin	GWASCAT_DG	30429480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21489227, 23593120, 24023349, 24065098, 25007960, 25862352, 26146447, 26865587, 28377418, 28547937, 28591216, 28599470, 29220587, 30465076, 30922314, 30953473 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	GWASDB_DG	23535729, 23535733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	23535733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	21347432, 22222214, 28849183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19542184, 30905413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21357378, 21445555, 22396042, 23835106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20976066, 23193118, 29260910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28849183, 30637548, 31243897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19542184, 19553294, 21179003, 22396042, 24023349, 25387436, 26146447, 26931363, 27600277, 28849183, 28881622, 29260910, 30105001, 30465076, 30894375, 30953473 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31827395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27449576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	23535733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	23535733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30922314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	23535733		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23455637, 23539184, 25407435, 31239444		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	23455637		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	GWASDB_DG	23455637		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	GWASCAT_DG	23455637, 28212542		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	23455637, 23539184	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory Disorders	Memory disorders	Pubtator	23551410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	21502950, 23164817, 25656382, 26047305, 26717541		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	23164817, 25656382		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	22247045, 31033179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	21131211, 24627050, 25498334, 25888059, 28626026, 30996080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	21379325, 25888059, 30091536, 32050935, 32955223, 33729310, 34713923, 36415696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	18339204, 18346983, 21146673, 21796137, 22457394, 23890480, 25367448, 26740239, 28738793, 28915859, 30091536, 30442880, 32028392, 34208143, 34454619, 38064210, 38201907 View all (2 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	18339204, 18346983, 18572014, 19818665, 20819567, 21741858, 21796137, 22189543, 22311015, 22457394, 23490278, 24624915, 24675148, 25367448, 26600519 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	GWASCAT_DG	22399527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	GWASDB_DG	22399527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	26740239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	25845303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	21502950		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	21502950		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth neoplasm	Pubtator	34378866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	36177774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	24532085, 31836807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31836807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	20031593, 22829130, 26772723, 29997116		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	20031593, 36061306	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopia	Myopia	Pubtator	37181702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	28977211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30637548, 30648791, 30922314, 31143705, 31519943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	19214238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	19214238, 22948233, 29982692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	23132673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	23132673	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	23132673	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24488767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24458218, 29486327, 29924135, 30388740		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30905413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nuclear cataract	Cataract	BEFREE	19329528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	BEFREE	19329528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17434869, 17496892, 17786212, 17890495, 17928949, 17942823, 17959933, 18048838, 18055244, 18058156, 18159244, 18218107, 18239580, 18249188, 18251005 View all (396 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	17434869, 17658951, 17786212, 17996046, 18048838, 18159244, 18218107, 18239580, 18335027, 18339204, 18346983, 18379722, 18426866, 18469204, 18487448 View all (402 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	17496892, 19079260, 19079261, 19151714, 19918250, 21076408		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	GWASCAT_DG	18159244, 19151714, 19553259, 20421936, 21544081, 21552555, 21706003, 23563607, 23563609		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	GWASDB_DG	18159244, 19151714, 19553259, 20421936, 21544081, 21552555, 21935397, 22484627, 23563607, 23563609		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	23424664, 33612620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	31852448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	17496892, 18058156, 18249188, 18347269, 18379722, 19680540, 19818665, 21220935, 22030988, 24675148, 27581034, 29466028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	26726774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	23535733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	22763110, 22956599, 23921993, 29606151, 34812958, 37217897	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis Knee	Osteoarthritis	Pubtator	23921993, 36089590, 38442374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	23921993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	GWASCAT_DG	30664745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	GWASCAT_DG	30664745		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	BEFREE	22125610, 30279140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	22125610, 35090337, 35511874, 36034449, 36967763, 39336743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	33952279	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	37871609	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	29384212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37674251, 38025760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21357378, 21445555, 22396042, 23835106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21445555, 23835106, 35879877, 37605223, 38057853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35404184	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	17496892, 18335027, 20090391, 20379142, 21798115, 23091647, 23349760, 24278475, 24289790, 24331679, 25135377, 25402378, 25953783, 26222659, 29238857, 30104138, 30896429 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	CTD_human_DG	25137265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	18478198, 18572014, 19625203, 19859840, 19913856, 20092643, 21283731, 22385136, 22389004, 22443257, 22801903, 22847851, 24466303, 24498077, 25086788 View all (10 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	18478198, 18572014		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	20092643, 21283731, 22389004, 23840863, 25592819, 26032905, 26722565, 29463151, 30496407, 30596735, 32050935, 33914321, 37710301, 40258223	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Presenile dementia	Senile Dementia	BEFREE	21098976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20976066, 23193118		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20976066, 23193118, 34787056, 37647111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	30733965	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	22247045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	28977211, 36888776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32961012, 33057025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29154870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	29657248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	30166627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	32076017, 34302448	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	23236985, 25278160		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	23236985	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	38470396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	21687707, 30967578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29504848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	22377712	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	30600310, 33243845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	30334133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	30334133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31519943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34378866	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29842885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31519943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29924135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28849183, 30637548, 31243897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30637548, 33393595, 35730319, 36918410, 38082402, 38200441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	21921652	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	27207655, 34837923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35090515	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Hormone Metabolism Abnormal	Thyroid hormone metabolism disorder	Pubtator	27920511	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	33285050, 36389678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	40022434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	24809401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32299393	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33634966, 37538000	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34499008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urolithiasis	Urolithiasis	GWASCAT_DG	30975718		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34564982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	37175660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	27768255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	27768255, 39343042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	28301549, 28528403, 29325734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	25161014	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	39457420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Xanthomatosis, Cerebrotendinous	Cholestanol storage disease	BEFREE	31316467		★★★★★ ★☆☆☆☆ Found in Text Mining only

FTO (FTO alpha-ketoglutarate dependent dioxygenase)