TRPM8 (transient receptor potential cation channel subfamily M member 8)

Gene

• Entrez ID: 79054
• Gene name: Transient receptor potential cation channel subfamily M member 8
• Gene symbol: TRPM8
• Synonyms (NCBI Gene): LTRPC6, LTrpC-6, TRPP8, trp-p8
• Chromosome: 2
• Chromosome location: 2q37.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018725	hsa-miR-335-5p	Microarray	18185580
MIRT1457570	hsa-miR-122	CLIP-seq
MIRT1457571	hsa-miR-1237	CLIP-seq
MIRT1457572	hsa-miR-1245	CLIP-seq
MIRT1457573	hsa-miR-1293	CLIP-seq
MIRT1457574	hsa-miR-1913	CLIP-seq
MIRT1457575	hsa-miR-205	CLIP-seq
MIRT1457576	hsa-miR-23a	CLIP-seq
MIRT1457577	hsa-miR-23b	CLIP-seq
MIRT1457578	hsa-miR-23c	CLIP-seq
MIRT1457579	hsa-miR-3121-3p	CLIP-seq
MIRT1457580	hsa-miR-3135b	CLIP-seq
MIRT1457581	hsa-miR-3148	CLIP-seq
MIRT1457582	hsa-miR-3159	CLIP-seq
MIRT1457583	hsa-miR-324-3p	CLIP-seq
MIRT1457584	hsa-miR-338-5p	CLIP-seq
MIRT1457585	hsa-miR-3614-3p	CLIP-seq
MIRT1457586	hsa-miR-3652	CLIP-seq
MIRT1457587	hsa-miR-3664-5p	CLIP-seq
MIRT1457588	hsa-miR-3688-3p	CLIP-seq
MIRT1457589	hsa-miR-3942-5p	CLIP-seq
MIRT1457590	hsa-miR-4294	CLIP-seq
MIRT1457591	hsa-miR-4303	CLIP-seq
MIRT1457592	hsa-miR-4430	CLIP-seq
MIRT1457593	hsa-miR-4433	CLIP-seq
MIRT1457594	hsa-miR-4483	CLIP-seq
MIRT1457595	hsa-miR-4639-3p	CLIP-seq
MIRT1457596	hsa-miR-4651	CLIP-seq
MIRT1457597	hsa-miR-4682	CLIP-seq
MIRT1457598	hsa-miR-4700-3p	CLIP-seq
MIRT1457599	hsa-miR-4703-5p	CLIP-seq
MIRT1457600	hsa-miR-4707-5p	CLIP-seq
MIRT1457601	hsa-miR-4735-5p	CLIP-seq
MIRT1457602	hsa-miR-4777-3p	CLIP-seq
MIRT1457603	hsa-miR-4789-3p	CLIP-seq
MIRT1457604	hsa-miR-5095	CLIP-seq
MIRT1457605	hsa-miR-5096	CLIP-seq
MIRT1457606	hsa-miR-548aa	CLIP-seq
MIRT1457607	hsa-miR-548ac	CLIP-seq
MIRT1457608	hsa-miR-548d-3p	CLIP-seq
MIRT1457609	hsa-miR-548z	CLIP-seq
MIRT1457610	hsa-miR-608	CLIP-seq
MIRT1457611	hsa-miR-643	CLIP-seq
MIRT1457612	hsa-miR-651	CLIP-seq
MIRT1457613	hsa-miR-767-5p	CLIP-seq
MIRT1457614	hsa-miR-876-3p	CLIP-seq
MIRT1457572	hsa-miR-1245	CLIP-seq
MIRT2137216	hsa-miR-1256	CLIP-seq
MIRT2137217	hsa-miR-1281	CLIP-seq
MIRT1457574	hsa-miR-1913	CLIP-seq
MIRT2137218	hsa-miR-1915	CLIP-seq
MIRT2137219	hsa-miR-3187-3p	CLIP-seq
MIRT1457583	hsa-miR-324-3p	CLIP-seq
MIRT2137220	hsa-miR-338-3p	CLIP-seq
MIRT2137221	hsa-miR-3663-5p	CLIP-seq
MIRT2137222	hsa-miR-3672	CLIP-seq
MIRT1457589	hsa-miR-3942-5p	CLIP-seq
MIRT2137223	hsa-miR-4420	CLIP-seq
MIRT2137224	hsa-miR-4435	CLIP-seq
MIRT2137225	hsa-miR-4461	CLIP-seq
MIRT2137226	hsa-miR-4530	CLIP-seq
MIRT2137227	hsa-miR-4645-5p	CLIP-seq
MIRT2137228	hsa-miR-4673	CLIP-seq
MIRT2137229	hsa-miR-4701-5p	CLIP-seq
MIRT1457599	hsa-miR-4703-5p	CLIP-seq
MIRT2137230	hsa-miR-4726-3p	CLIP-seq
MIRT2137231	hsa-miR-4755-3p	CLIP-seq
MIRT2137232	hsa-miR-4772-3p	CLIP-seq
MIRT2137233	hsa-miR-548s	CLIP-seq
MIRT2137234	hsa-miR-588	CLIP-seq
MIRT2137235	hsa-miR-659	CLIP-seq
MIRT1457570	hsa-miR-122	CLIP-seq
MIRT2137217	hsa-miR-1281	CLIP-seq
MIRT2137218	hsa-miR-1915	CLIP-seq
MIRT1457580	hsa-miR-3135b	CLIP-seq
MIRT2357966	hsa-miR-3180-5p	CLIP-seq
MIRT2137219	hsa-miR-3187-3p	CLIP-seq
MIRT2357967	hsa-miR-3199	CLIP-seq
MIRT2357968	hsa-miR-320a	CLIP-seq
MIRT2357969	hsa-miR-320b	CLIP-seq
MIRT2357970	hsa-miR-320c	CLIP-seq
MIRT2357971	hsa-miR-320d	CLIP-seq
MIRT2357972	hsa-miR-320e	CLIP-seq
MIRT2357973	hsa-miR-3646	CLIP-seq
MIRT1457586	hsa-miR-3652	CLIP-seq
MIRT2137221	hsa-miR-3663-5p	CLIP-seq
MIRT2357974	hsa-miR-3919	CLIP-seq
MIRT2357975	hsa-miR-3978	CLIP-seq
MIRT2137223	hsa-miR-4420	CLIP-seq
MIRT2357976	hsa-miR-4429	CLIP-seq
MIRT1457592	hsa-miR-4430	CLIP-seq
MIRT2137224	hsa-miR-4435	CLIP-seq
MIRT2357977	hsa-miR-4659a-5p	CLIP-seq
MIRT2357978	hsa-miR-4659b-5p	CLIP-seq
MIRT2137229	hsa-miR-4701-5p	CLIP-seq
MIRT1457600	hsa-miR-4707-5p	CLIP-seq
MIRT2357979	hsa-miR-4716-5p	CLIP-seq
MIRT2137230	hsa-miR-4726-3p	CLIP-seq
MIRT2137231	hsa-miR-4755-3p	CLIP-seq
MIRT2137232	hsa-miR-4772-3p	CLIP-seq
MIRT2357980	hsa-miR-4776-3p	CLIP-seq
MIRT2357981	hsa-miR-4781-3p	CLIP-seq
MIRT2357982	hsa-miR-520a-5p	CLIP-seq
MIRT2357983	hsa-miR-525-5p	CLIP-seq
MIRT2137233	hsa-miR-548s	CLIP-seq
MIRT2137234	hsa-miR-588	CLIP-seq
MIRT2137235	hsa-miR-659	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005262	Function	Calcium channel activity	IEA
GO:0005262	Function	Calcium channel activity	TAS
GO:0005515	Function	Protein binding	IPI	25559186
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	25559186
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0009266	Process	Response to temperature stimulus	IEA
GO:0009409	Process	Response to cold	IEA
GO:0009409	Process	Response to cold	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0044853	Component	Plasma membrane raft	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046873	Function	Metal ion transmembrane transporter activity	IEA
GO:0050955	Process	Thermoception	IBA
GO:0050955	Process	Thermoception	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IBA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	TAS
GO:0099604	Function	Ligand-gated calcium channel activity	IBA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IBA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	22241835

Other IDs

• MIM: 606678
• HGNC: 17961
• e!Ensembl: ENSG00000144481

Protein

• UniProt ID: Q7Z2W7
• Protein name: Transient receptor potential cation channel subfamily M member 8 (Long transient receptor potential channel 6) (LTrpC-6) (LTrpC6) (Transient receptor potential p8) (Trp-p8)
• Protein function: Non-selective ion channel permeable to monovalent and divalent cations, including Na(+), K(+), and Ca(2+), with higher permeability for Ca(2+). Activated by multiple factors, such as temperature, voltage, pressure, and changes in osmolality. Act
• PDB: 8BDC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF18139	LSDAT_euk	115 → 387	SLOG in TRPM	Family
  PF00520	Ion_trans	736 → 991	Ion transport protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in prostate. Also expressed in prostate tumors and in non-prostatic primary tumors such as colon, lung, breast and skin tumors. {ECO:0000269|PubMed:11325849, ECO:0000269|PubMed:12858355, ECO:0000269|PubMed:16174775, ECO:00002
• Sequence:

  MSFRAARLSMRNRRNDTLDSTRTLYSSASRSTDLSYSESDLVNFIQANFKKRECVFFTKD
  SKATENVCKCGYAQSQHMEGTQINQSEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYIRL
  SCDTDAEILYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWIL
  TGGTHYGLMKYIGEVVRDNTISRSSEENIVAIGIAAWGMVSNRDTLIRNCDAEGYFLAQY
  LMDDFTRDPLYILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP
  IVCFAQGGGKETLKAINTSIKNKIPCVVVEGSGQIADVIASLVEVEDALTSSAVKEKLVR
  FLPRTVSRLPEEETESWIKWLKEILECSHLLTVIKMEEAGDEIVSNAISYALYKAFSTSE
  QDKDNWNGQLKLLLEWNQLDLANDEIFTNDRRWESADLQEVMFTALIKDRPKFVRLFLEN
  GLNLRKFLTHDVLTELFSNHFSTLVYRNLQIAKNSYNDALLTFVWKLVANFRRGFRKEDR
  NGRDEMDIELHDVSPITRHPLQALFIWAILQNKKELSKVIWEQTRGCTLAALGASKLLKT
  LAKVKNDINAAGESEELANEYETRAVELFTECYSSDEDLAEQLLVYSCEAWGGSNCLELA
  VEATDQHFIAQPGVQNFLSKQWYGEISRDTKNWKIILCLFIIPLVGCGFVSFRKKPVDKH
  KKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFAYVLLMDFHSVPHPPELVLYSLVFVLFC
  DEVRQWYVNGVNYFTDLWNVMDTLGLFYFIAGIVFRLHSSNKSSLYSGRVIFCLDYIIFT
  LRLIHIFTVSRNLGPKIIMLQRMLIDVFFFLFLFAVWMVAFGVARQGILRQNEQRWRWIF
  RSVIYEPYLAMFGQVPSDVDGTTYDFAHCTFTGNESKPLCVELDEHNLPRFPEWITIPLV
  CIYMLSTNILLVNLLVAMFGYTVGTVQENNDQVWKFQRYFLVQEYCSRLNIPFPFIVFAY
  FYMVVKKCFKCCCKEKNMESSVCCFKNEDNETLAWEGVMKENYLVKINTKANDTSEEMRH
  RFRQLDTKLNDLKGLLKEIANKIK

• Sequence length: 1104

Pathways

KEGG:

Inflammatory mediator regulation of TRP channels

Reactome:

TRP channels

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ANEURYSM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON MIGRAINE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE WITH AURA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE WITHOUT AURA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPORADIC AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abdominal Migraine	Abdominal Migraine	CTD_human_DG	21666692		★☆☆☆☆ Found in Text Mining only
Acute Confusional Migraine	Confusional Migraine	CTD_human_DG	21666692		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	20482834, 30316690		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	20605675, 22555807, 27038374		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	18441098	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	20932257, 26272603, 26803314, 29635321		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma Occupational	Asthma	Pubtator	28255167	Associate	★☆☆☆☆ Found in Text Mining only
Asthma, Occupational	Asthma	BEFREE	28255167		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	28839241	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30344743		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20482834, 24903376, 29496495		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20482834, 33020304	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24903376	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22555807, 25128062	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25128062		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24037916, 26708603		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28857015	Associate	★☆☆☆☆ Found in Text Mining only
Cervical Migraine Syndrome	Migraine	CTD_human_DG	21666692		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21762971		★☆☆☆☆ Found in Text Mining only
Chronic Prostatitis with Chronic Pelvic Pain Syndrome	Prostatitis With Chronic Pelvic Pain Syndrome	BEFREE	28499240		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	37203044	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	23596210, 25269705		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25269802, 26803314		★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	CTD_human_DG	22683712		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Migraine	Common Migraine	GWASDB_DG	23793025		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital thrombotic disease due to Protein C deficiency	Congenital thrombotic thrombocytopenic purpura	Pubtator	31273254	Associate	★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	25269705		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	30545944		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	17521436, 36430572	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	28861042, 28933582, 30046815, 30545944, 31157834		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	36796252	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	30545944		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31263415		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	31340190		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	31519770		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	31519770		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	31519770	Stimulate	★☆☆☆☆ Found in Text Mining only
Excessive tearing	Excessive Tearing	BEFREE	29664111		★☆☆☆☆ Found in Text Mining only
Familial cold urticaria	Cold urticaria	BEFREE	26843440, 31488702		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18485891, 28693898, 29221175, 31524272		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26088448, 39581355	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18485891, 28693898, 29221175, 31524272		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29221175		★☆☆☆☆ Found in Text Mining only
Heart Block	Heart Block	BEFREE	28038937		★☆☆☆☆ Found in Text Mining only
Hemicrania migraine	Hemicrania Migraine	CTD_human_DG	21666692		★☆☆☆☆ Found in Text Mining only
Hyperalgesia	Hyperalgesia	Pubtator	17889683, 31842742	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	24165912	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	27789940	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension, Renovascular	Hypertension	BEFREE	28138709		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28138709, 28768647, 29560109, 31340190		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	29560109		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	28025641	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20482834, 24903376, 29496495		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	31519770		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	26708603		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24037916, 26708603		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27038374, 29860264, 30316690, 31834994		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11325849, 12874026, 15947109, 16174775, 16921506, 17510704, 18955132, 19234481, 20531306, 21788966, 22267123, 22437241, 23251635, 24517338, 25980497, 28039451, 28550110, 29541177, 30858386, 31138874, 31305891, 31501416		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20932257, 24037916, 24391455, 24641366, 24903376, 26803314, 27038374, 28039451, 28883526, 29926226		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	18524940, 22897572, 24641366, 26803314		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
melanoma	Melanoma	LHGDN	18524940		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Melanoma	Melanoma	Pubtator	18524940, 22897572, 24641366	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Metabolic Syndrome	Metabolic syndrome	Pubtator	25967713	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	25967713		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	17616360		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	21666692, 22683712, 23294458, 24021092, 24266335, 24666033, 24852292, 27634619, 28554243, 30148953, 30635810		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	CTD_human_DG	21666692		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	Pubtator	21666692, 22683712, 24674449, 24852292, 26660531, 29723195, 31842742, 31873179	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	GWASDB_DG	22683712, 23793025		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	GWASCAT_DG	23793025		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine with Aura	Migraine with Aura	GWASDB_DG	23793025		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine with Aura	Migraine with Aura	BEFREE	24021092, 25388962		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine with Aura	Migraine	Pubtator	26660531	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	30344743		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29114087		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31648306		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16921506, 18524940, 18955132, 22178934, 22555807, 25128062, 26803314, 27038374, 28039451, 28857015, 29221175, 29860264, 30316690, 30344743, 30483120, 31519770, 31729029		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19507192		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	LHGDN	17426390		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	21945155		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	31850745		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22241835, 29530988, 30353008, 31141957		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27421018	Associate	★☆☆☆☆ Found in Text Mining only
Oropharyngeal Dysphagia	Oropharyngeal Dysphagia	BEFREE	28799699, 29971861		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24391455		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24391455	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27038374, 29860264, 30316690, 31834994		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	24658318, 28857015		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	27038374		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20605675, 22555807, 28857015, 29860264, 36012311	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	22555807	Associate	★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	24658318		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	35806193	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11325849, 12874026, 15947109, 16174775, 16921506, 17510704, 18955132, 19234481, 20531306, 21788966, 22267123, 22437241, 23251635, 24517338, 25980497, 28039451, 28550110, 29541177, 30858386, 31138874, 31305891, 31501416		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic disease	Pubtator	33955429	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	37781794	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16174775, 17510704		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17510704, 18955132, 19234481, 21623387, 22128173, 22437241, 23251635, 23391636, 24517338, 25980497, 28039451, 28550110, 31501416, 33955429, 35570407, 37781794	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	25980497, 26803314, 30542701		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	27789940	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28499580		★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	29698501		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	26708603		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	Pubtator	28767579	Associate	★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	33955429	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22267123		★☆☆☆☆ Found in Text Mining only
Status Migrainosus	Status Migrainosus	CTD_human_DG	21666692		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary Bladder Diseases	BEFREE	29464762		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25128062	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	25128062		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	21906810		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	30483120		★☆☆☆☆ Found in Text Mining only