Gene Gene information from NCBI Gene database.
Entrez ID 79037
Gene name PVR related immunoglobulin domain containing
Gene symbol PVRIG
Synonyms (NCBI Gene)
C7orf15CD112R
Chromosome 7
Chromosome location 7q22.1
miRNA miRNA information provided by mirtarbase database.
149
miRTarBase ID miRNA Experiments Reference
MIRT614344 hsa-miR-603 HITS-CLIP 19536157
MIRT614343 hsa-miR-1228-3p HITS-CLIP 19536157
MIRT614342 hsa-miR-1914-5p HITS-CLIP 19536157
MIRT614341 hsa-miR-342-3p HITS-CLIP 19536157
MIRT614340 hsa-miR-6889-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 26755705, 32296183
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 26755705
GO:0005886 Component Plasma membrane IEA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
617012 32190 ENSG00000213413
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6DKI7
Protein name Transmembrane protein PVRIG (CD112 receptor) (CD112R) (Poliovirus receptor-related immunoglobulin domain-containing protein)
Protein function Cell surface receptor for NECTIN2. May act as a coinhibitory receptor that suppresses T-cell receptor-mediated signals. Following interaction with NECTIN2, inhibits T-cell proliferation. Competes with CD226 for NECTIN2-binding. {ECO:0000269|PubM
PDB 8X6B
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in some types of immune cells. Expressed at low levels on the surface of freshly isolated T-cells and natural killer (NK) cells, predominantly on CD8+ T-cells (mainly memory/effector, but not naive cells) and on both CD16+ an
Sequence
MRTEAQVPALQPPEPGLEGAMGHRTLVLPWVLLTLCVTAGTPEVWVQVRMEATELSSFTI
RCGFLGSGSISLVTVSWGGPNGAGGTTLAVLHPERGIRQWAPARQARWETQSSISLILEG
SGASSPCANTTFCCKFASFPEGSWEACGSLPPSSDPGLSAPPTPAPILRADLAGILGVSG
VLLFGCVYLLHLLRRHKHRPAPRLQPSRTSPQAPRARAWAPSQASQAALHVPYATINTSC
RPATLDTAHPHGGPSWWASLPTHAAHRPQGPAAWASTPIPARGSFVSVENGLYAQAGERP
PHTGPGLTLFPDPRGPRAMEGPLGVR
Sequence length 326
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CHRONIC OBSTRUCTIVE PULMONARY DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 37542274 Stimulate
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 31807510
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 36788088 Stimulate
★☆☆☆☆
Found in Text Mining only
leukemia Leukemia BEFREE 31234588
★☆☆☆☆
Found in Text Mining only
Leukemia Myeloid Acute Myeloid leukemia Pubtator 33147937 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer BEFREE 31807510
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 30659054
★☆☆☆☆
Found in Text Mining only