Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	79006
Gene name	Meteorin, glial cell differentiation regulator
Gene symbol	METRN
Synonyms (NCBI Gene)	C16orf23c380A1.2
Chromosome	16
Chromosome location	16p13.3
Summary	Meteorin regulates glial cell differentiation and promotes the formation of axonal networks during neurogenesis (Nishino et al., 2004 [PubMed 15085178]).[supplied by OMIM, Mar 2008]

Show/Hide all (42)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029770	hsa-miR-26b-5p	Microarray	19088304
MIRT040596	hsa-miR-92b-3p	CLASH	23622248
MIRT444003	hsa-miR-873-3p	HITS-CLIP	23824327
MIRT444002	hsa-miR-924	HITS-CLIP	23824327
MIRT444001	hsa-miR-3672	HITS-CLIP	23824327
MIRT444000	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT443999	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT443998	hsa-miR-627-5p	HITS-CLIP	23824327
MIRT443997	hsa-miR-8081	HITS-CLIP	23824327
MIRT443996	hsa-miR-8055	HITS-CLIP	23824327
MIRT443995	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT444003	hsa-miR-873-3p	PAR-CLIP	22100165
MIRT444002	hsa-miR-924	PAR-CLIP	22100165
MIRT444001	hsa-miR-3672	PAR-CLIP	22100165
MIRT444000	hsa-miR-6864-3p	PAR-CLIP	22100165
MIRT443999	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT443998	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT443997	hsa-miR-8081	PAR-CLIP	22100165
MIRT443996	hsa-miR-8055	PAR-CLIP	22100165
MIRT443995	hsa-miR-129-5p	PAR-CLIP	22100165
MIRT444003	hsa-miR-873-3p	HITS-CLIP	23824327
MIRT444002	hsa-miR-924	HITS-CLIP	23824327
MIRT444001	hsa-miR-3672	HITS-CLIP	23824327
MIRT444000	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT443999	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT443998	hsa-miR-627-5p	HITS-CLIP	23824327
MIRT443997	hsa-miR-8081	HITS-CLIP	23824327
MIRT443996	hsa-miR-8055	HITS-CLIP	23824327
MIRT443995	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT444003	hsa-miR-873-3p	PAR-CLIP	22100165
MIRT444002	hsa-miR-924	PAR-CLIP	22100165
MIRT444001	hsa-miR-3672	PAR-CLIP	22100165
MIRT444000	hsa-miR-6864-3p	PAR-CLIP	22100165
MIRT443999	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT443998	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT443997	hsa-miR-8081	PAR-CLIP	22100165
MIRT443996	hsa-miR-8055	PAR-CLIP	22100165
MIRT443995	hsa-miR-129-5p	PAR-CLIP	22100165
MIRT1143646	hsa-miR-2355-5p	CLIP-seq
MIRT1143647	hsa-miR-3065-3p	CLIP-seq
MIRT1143648	hsa-miR-4749-3p	CLIP-seq
MIRT1143649	hsa-miR-634	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence
GO:0005179	Function	Hormone activity	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007409	Process	Axonogenesis	IEA
GO:0010001	Process	Glial cell differentiation	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0050772	Process	Positive regulation of axonogenesis	IBA
GO:0050772	Process	Positive regulation of axonogenesis	IEA
GO:0060019	Process	Radial glial cell differentiation	IEA

MIM	HGNC	e!Ensembl
610998	14151	ENSG00000103260

Q9UJH8

Protein name

Meteorin

Protein function

Involved in both glial cell differentiation and axonal network formation during neurogenesis. Promotes astrocyte differentiation and transforms cerebellar astrocytes into radial glia. Also induces axonal extension in small and intermediate neuro

Family and domains

Sequence

MGFPAAALLCALCCGLLAPAARAGYSEERCSWRGSGLTQEPGSVGQLALACAEGAVEWLY
PAGALRLTLGGPDPRARPGIACLRPVRPFAGAQVFAERAGGALELLLAEGPGPAGGRCVR
WGPRERRALFLQATPHQDISRRVAAFRFELREDGRPELPPQAHGLGVDGACRPCSDAELL
LAACTSDFVIHGIIHGVTHDVELQESVITVVAARVLRQTPPLFQAGRSGDQGLTSIRTPL
RCGVHPGPGTFLFMGWSRFGEARLGCAPRFQEFRRAYEAARAAHLHPCEVALH

Sequence length

293

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arteriosclerosis	Arteriosclerosis	BEFREE	30825562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30825562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31859449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30212581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30212581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30212581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29199003, 30212581, 30928991, 31635130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	20840868, 22426041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	31570005		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	20840868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	22426041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29854769, 31635130		★★★★★ ★☆☆☆☆ Found in Text Mining only

METRN (meteorin, glial cell differentiation regulator)