CUEDC2 (CUE domain containing 2)

Gene

• Entrez ID: 79004
• Gene name: CUE domain containing 2
• Gene symbol: CUEDC2
• Synonyms (NCBI Gene): C10orf66, bA18I14.5
• Chromosome: 10
• Chromosome location: 10q24.32

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT045300	hsa-miR-186-5p	CLASH	23622248
MIRT043568	hsa-miR-331-3p	CLASH	23622248
MIRT043183	hsa-miR-324-5p	CLASH	23622248
MIRT039666	hsa-miR-615-3p	CLASH	23622248
MIRT916366	hsa-miR-141	CLIP-seq
MIRT916367	hsa-miR-154	CLIP-seq
MIRT916368	hsa-miR-200a	CLIP-seq
MIRT916369	hsa-miR-3123	CLIP-seq
MIRT916370	hsa-miR-3154	CLIP-seq
MIRT916371	hsa-miR-3179	CLIP-seq
MIRT916372	hsa-miR-3925-5p	CLIP-seq
MIRT916373	hsa-miR-4278	CLIP-seq
MIRT916374	hsa-miR-4433	CLIP-seq
MIRT916375	hsa-miR-4653-3p	CLIP-seq
MIRT916376	hsa-miR-4716-3p	CLIP-seq
MIRT916377	hsa-miR-4802-5p	CLIP-seq
MIRT916366	hsa-miR-141	CLIP-seq
MIRT916368	hsa-miR-200a	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17347654, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0010936	Process	Negative regulation of macrophage cytokine production	IEA
GO:0010936	Process	Negative regulation of macrophage cytokine production	IMP	24882011
GO:0031965	Component	Nuclear membrane	IDA
GO:0043130	Function	Ubiquitin binding	IEA
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IEA
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IMP	24882011

Other IDs

• MIM: 614142
• HGNC: 28352
• e!Ensembl: ENSG00000107874

Protein

• UniProt ID: Q9H467
• Protein name: CUE domain-containing protein 2
• Protein function: Down-regulates ESR1 protein levels through the ubiquitination-proteasome pathway, regardless of the presence of 17 beta-estradiol. Also involved in 17 beta-estradiol-induced ESR1 degradation. Controls PGR protein levels through a similar mechani
• Tissue specificity: TISSUE SPECIFICITY: Significantly up-regulated in breast tumor tissues compared with matched adjacent normal tissues (at protein level). Levels inversely correlate with ESR1 in breast cancers and are lower in low-grade tumors compared to high-grade tumors
• Sequence:

  MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEM
  MEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEML
  KEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQ
  MLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSAEDQKIHRPMAPKEA
  PKKLIRYIDNQVVSTKGERFKDVRNPEAEEMKATYINLKPARKYRFH

• Sequence length: 287

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26023733		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30630471		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	30630471	Associate	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	35732909	Stimulate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	30610940		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17347654		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17347654, 35732909	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28325773, 28534933, 36231027	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28325773	Associate	★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	25534755		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	24882011		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24882011, 30651016		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30651016		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30651016	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	35732909	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28534933		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28534933	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29991678		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30651016	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17347654		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24882011, 28325773		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24882011, 30651016		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17347654		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	24125838		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21743465, 26023733, 31205536		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32967504	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	31205536		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36231027	Associate	★☆☆☆☆ Found in Text Mining only