AUNIP (aurora kinase A and ninein interacting protein)

Gene

• Entrez ID: 79000
• Gene name: Aurora kinase A and ninein interacting protein
• Gene symbol: AUNIP
• Synonyms (NCBI Gene): AIBP, C1orf135
• Chromosome: 1
• Chromosome location: 1p36.11

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016381	hsa-miR-193b-3p	Microarray	20304954
MIRT030388	hsa-miR-24-3p	Microarray	19748357
MIRT041773	hsa-miR-484	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000724	Process	Double-strand break repair via homologous recombination	IDA	29042561
GO:0000922	Component	Spindle pole	IBA
GO:0000922	Component	Spindle pole	IDA	20596670
GO:0000922	Component	Spindle pole	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003684	Function	Damaged DNA binding	IDA	29042561
GO:0005515	Function	Protein binding	IPI	20596670, 28514442, 29042561, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	20596670
GO:0005813	Component	Centrosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0007051	Process	Spindle organization	IBA
GO:0007051	Process	Spindle organization	IMP	20596670
GO:0090734	Component	Site of DNA damage	IDA	29042561
GO:2001033	Process	Negative regulation of double-strand break repair via nonhomologous end joining	IDA	29042561

Other IDs

• MIM: 620397
• HGNC: 28363
• e!Ensembl: ENSG00000127423

Protein

• UniProt ID: Q9H7T9
• Protein name: Aurora kinase A- and ninein-interacting protein (AIBp)
• Protein function: DNA-binding protein that accumulates at DNA double-strand breaks (DSBs) following DNA damage and promotes DNA resection and homologous recombination (PubMed:29042561). Serves as a sensor of DNA damage: binds DNA with a strong preference for DNA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15334	AIB	26 → 350	Aurora kinase A and ninein interacting protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in heart, skeletal muscles, placenta and testis.
• Sequence:

  MRRTGPEEEACGVWLDAAALKRRKVQTHLIKPGTKMLTLLPGERKANIYFTQRRAPSTGI
  HQRSIASFFTLQPGKTNGSDQKSVSSHTESQINKESKKNATQLDHLIPGLAHDCMASPLA
  TSTTADIQEAGLSPQSLQTSGHHRMKTPFSTELSLLQPDTPDCAGDSHTPLAFSFTEDLE
  SSCLLDRKEEKGDSARKWEWLHESKKNYQSMEKHTKLPGDKCCQPLGKTKLERKVSAKEN
  RQAPVLLQTYRESWNGENIESVKQSRSPVSVFSWDNEKNDKDSWSQLFTEDSQGQRVIAH
  NTRAPFQDVTNNWNWDLGPFPNSPWAQCQEDGPTQNLKPDLLFTQDSEGNQVIRHQF

• Sequence length: 357

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Atherosclerosis	Atherosclerosis	BEFREE	30705153		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31409573		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37348876	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	31409573		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31409573	Associate	★☆☆☆☆ Found in Text Mining only