CYREN (cell cycle regulator of NHEJ)

Gene

• Entrez ID: 78996
• Gene name: Cell cycle regulator of NHEJ
• Gene symbol: CYREN
• Synonyms (NCBI Gene): C7orf49, CYREN-1, CYREN-2, MRI, MRI-2
• Chromosome: 7
• Chromosome location: 7q33

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003684	Function	Damaged DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	24610814, 28959974, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	24610814
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	24610814
GO:0005737	Component	Cytoplasm	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006303	Process	Double-strand break repair via nonhomologous end joining	IBA
GO:0006303	Process	Double-strand break repair via nonhomologous end joining	IDA	24610814
GO:0006303	Process	Double-strand break repair via nonhomologous end joining	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0033152	Process	Immunoglobulin V(D)J recombination	IEA
GO:0033152	Process	Immunoglobulin V(D)J recombination	ISS
GO:0035861	Component	Site of double-strand break	IEA
GO:0035861	Component	Site of double-strand break	ISS
GO:1990166	Process	Protein localization to site of double-strand break	IEA
GO:1990391	Component	DNA repair complex	IEA
GO:2001033	Process	Negative regulation of double-strand break repair via nonhomologous end joining	IDA	28959974
GO:2001033	Process	Negative regulation of double-strand break repair via nonhomologous end joining	IEA
GO:2001034	Process	Positive regulation of double-strand break repair via nonhomologous end joining	IEA

Other IDs

• MIM: 616980
• HGNC: 22432
• e!Ensembl: ENSG00000122783

Protein

• UniProt ID: Q9BWK5
• Protein name: Cell cycle regulator of non-homologous end joining (Cell cycle regulator of NHEJ) (Modulator of retrovirus infection homolog)
• Protein function: Cell-cycle-specific regulator of classical non-homologous end joining (NHEJ) of DNA double-strand break (DSB) repair, which can act both as an activator or inhibitor of NHEJ, depending on the cell cycle phase (PubMed:24610814, PubMed:28959974).
• PDB: 6TYU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15325	MRI	52 → 157	Modulator of retrovirus infection	Family

• Sequence:

  METLQSETKTRVLPSWLTAQVATKNVAPMKAPKRMRMAAVPVAAARLPATRTVYCMNEAE
  IVDVALGILIESRKQEKACEQPALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQALAP
  GLSPSQRPGGSSSACSRSPEEEEEEDVLKYVREIFFS

• Sequence length: 157

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Cortical cataract	Cortical cataract	BEFREE	28935163		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	28935163		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27438142, 28157066, 28306604, 28381220, 28651247, 28725586, 29025845, 29552975, 29594027, 29679430, 29988101, 30054684, 31022301, 31197523, 31201191, 31326219, 31522235, 31786702		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28306604, 29552975		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29953911		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27438142, 28157066, 28306604, 28381220, 28651247, 28725586, 29025845, 29552975, 29594027, 29679430, 29988101, 30054684, 31022301, 31197523, 31201191, 31326219, 31522235, 31786702		★☆☆☆☆ Found in Text Mining only