Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7867
Gene name	MAPK activated protein kinase 3
Gene symbol	MAPKAPK3
Synonyms (NCBI Gene)	3PKMAPKAP-K3MAPKAP3MAPKAPK-3MDPT3MK-3MK3
Chromosome	3
Chromosome location	3p21.2
Summary	This gene encodes a member of the Ser/Thr protein kinase family. This kinase functions as a mitogen-activated protein kinase (MAP kinase)- activated protein kinase. MAP kinases are also known as extracellular signal-regulated kinases (ERKs), act as an int

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs886037913	T>C	Pathogenic	Missense variant, intron variant, coding sequence variant

121

Show/Hide all (121)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022623	hsa-miR-124-3p	Microarray	18668037
MIRT1131494	hsa-miR-1179	CLIP-seq
MIRT1131495	hsa-miR-1266	CLIP-seq
MIRT1131496	hsa-miR-1291	CLIP-seq
MIRT1131497	hsa-miR-1321	CLIP-seq
MIRT1131498	hsa-miR-1827	CLIP-seq
MIRT1131499	hsa-miR-214	CLIP-seq
MIRT1131500	hsa-miR-2682	CLIP-seq
MIRT1131501	hsa-miR-27a	CLIP-seq
MIRT1131502	hsa-miR-27b	CLIP-seq
MIRT1131503	hsa-miR-3065-3p	CLIP-seq
MIRT1131504	hsa-miR-3126-3p	CLIP-seq
MIRT1131505	hsa-miR-3127-5p	CLIP-seq
MIRT1131506	hsa-miR-3136-3p	CLIP-seq
MIRT1131507	hsa-miR-3173-3p	CLIP-seq
MIRT1131508	hsa-miR-3173-5p	CLIP-seq
MIRT1131509	hsa-miR-338-3p	CLIP-seq
MIRT1131510	hsa-miR-3612	CLIP-seq
MIRT1131511	hsa-miR-3619-5p	CLIP-seq
MIRT1131512	hsa-miR-3677-5p	CLIP-seq
MIRT1131513	hsa-miR-3918	CLIP-seq
MIRT1131514	hsa-miR-4269	CLIP-seq
MIRT1131515	hsa-miR-4270	CLIP-seq
MIRT1131516	hsa-miR-4310	CLIP-seq
MIRT1131517	hsa-miR-4441	CLIP-seq
MIRT1131518	hsa-miR-4495	CLIP-seq
MIRT1131519	hsa-miR-449c	CLIP-seq
MIRT1131520	hsa-miR-4514	CLIP-seq
MIRT1131521	hsa-miR-4518	CLIP-seq
MIRT1131522	hsa-miR-4530	CLIP-seq
MIRT1131523	hsa-miR-4660	CLIP-seq
MIRT1131524	hsa-miR-4690-5p	CLIP-seq
MIRT1131525	hsa-miR-4692	CLIP-seq
MIRT1131526	hsa-miR-4739	CLIP-seq
MIRT1131527	hsa-miR-4742-5p	CLIP-seq
MIRT1131528	hsa-miR-4747-3p	CLIP-seq
MIRT1131529	hsa-miR-4756-5p	CLIP-seq
MIRT1131530	hsa-miR-4764-5p	CLIP-seq
MIRT1131531	hsa-miR-4782-5p	CLIP-seq
MIRT1131532	hsa-miR-512-5p	CLIP-seq
MIRT1131533	hsa-miR-513a-5p	CLIP-seq
MIRT1131534	hsa-miR-548aa	CLIP-seq
MIRT1131535	hsa-miR-556-3p	CLIP-seq
MIRT1131536	hsa-miR-650	CLIP-seq
MIRT1131537	hsa-miR-761	CLIP-seq
MIRT1131538	hsa-miR-940	CLIP-seq
MIRT2037448	hsa-miR-150	CLIP-seq
MIRT2037449	hsa-miR-377	CLIP-seq
MIRT2037450	hsa-miR-4691-3p	CLIP-seq
MIRT2037451	hsa-miR-4731-3p	CLIP-seq
MIRT2037452	hsa-miR-4801	CLIP-seq
MIRT1131532	hsa-miR-512-5p	CLIP-seq
MIRT2037453	hsa-miR-550b	CLIP-seq
MIRT2267365	hsa-miR-128	CLIP-seq
MIRT1131501	hsa-miR-27a	CLIP-seq
MIRT1131502	hsa-miR-27b	CLIP-seq
MIRT1131503	hsa-miR-3065-3p	CLIP-seq
MIRT2267366	hsa-miR-3140-3p	CLIP-seq
MIRT2267367	hsa-miR-3929	CLIP-seq
MIRT1131514	hsa-miR-4269	CLIP-seq
MIRT2267368	hsa-miR-4419b	CLIP-seq
MIRT2267369	hsa-miR-4478	CLIP-seq
MIRT2267370	hsa-miR-4492	CLIP-seq
MIRT2267371	hsa-miR-4498	CLIP-seq
MIRT1131520	hsa-miR-4514	CLIP-seq
MIRT2267372	hsa-miR-4640-5p	CLIP-seq
MIRT2267373	hsa-miR-4676-5p	CLIP-seq
MIRT1131525	hsa-miR-4692	CLIP-seq
MIRT2267374	hsa-miR-4726-5p	CLIP-seq
MIRT1131527	hsa-miR-4742-5p	CLIP-seq
MIRT1131532	hsa-miR-512-5p	CLIP-seq
MIRT2267375	hsa-miR-575	CLIP-seq
MIRT2267376	hsa-miR-762	CLIP-seq
MIRT2390611	hsa-miR-4281	CLIP-seq
MIRT1131520	hsa-miR-4514	CLIP-seq
MIRT1131525	hsa-miR-4692	CLIP-seq
MIRT2037448	hsa-miR-150	CLIP-seq
MIRT2567152	hsa-miR-186	CLIP-seq
MIRT2567153	hsa-miR-1912	CLIP-seq
MIRT2567154	hsa-miR-3133	CLIP-seq
MIRT2567155	hsa-miR-3194-3p	CLIP-seq
MIRT2567156	hsa-miR-3651	CLIP-seq
MIRT2037449	hsa-miR-377	CLIP-seq
MIRT2567157	hsa-miR-3943	CLIP-seq
MIRT2567158	hsa-miR-4311	CLIP-seq
MIRT2567159	hsa-miR-4323	CLIP-seq
MIRT2567160	hsa-miR-4506	CLIP-seq
MIRT2567161	hsa-miR-4662a-3p	CLIP-seq
MIRT2037450	hsa-miR-4691-3p	CLIP-seq
MIRT2037451	hsa-miR-4731-3p	CLIP-seq
MIRT2567162	hsa-miR-4747-5p	CLIP-seq
MIRT2567163	hsa-miR-4786-3p	CLIP-seq
MIRT2037452	hsa-miR-4801	CLIP-seq
MIRT2567164	hsa-miR-569	CLIP-seq
MIRT2567165	hsa-miR-671-5p	CLIP-seq
MIRT2567166	hsa-miR-767-3p	CLIP-seq
MIRT2567167	hsa-miR-769-5p	CLIP-seq
MIRT2037448	hsa-miR-150	CLIP-seq
MIRT2567152	hsa-miR-186	CLIP-seq
MIRT2567153	hsa-miR-1912	CLIP-seq
MIRT2684601	hsa-miR-296-3p	CLIP-seq
MIRT2567154	hsa-miR-3133	CLIP-seq
MIRT2684602	hsa-miR-3184	CLIP-seq
MIRT2567155	hsa-miR-3194-3p	CLIP-seq
MIRT2037449	hsa-miR-377	CLIP-seq
MIRT2684603	hsa-miR-423-5p	CLIP-seq
MIRT2567158	hsa-miR-4311	CLIP-seq
MIRT2567160	hsa-miR-4506	CLIP-seq
MIRT2267373	hsa-miR-4676-5p	CLIP-seq
MIRT2684604	hsa-miR-4685-5p	CLIP-seq
MIRT2037450	hsa-miR-4691-3p	CLIP-seq
MIRT2037451	hsa-miR-4731-3p	CLIP-seq
MIRT2567162	hsa-miR-4747-5p	CLIP-seq
MIRT2567163	hsa-miR-4786-3p	CLIP-seq
MIRT2037452	hsa-miR-4801	CLIP-seq
MIRT2567164	hsa-miR-569	CLIP-seq
MIRT2267375	hsa-miR-575	CLIP-seq
MIRT2684605	hsa-miR-601	CLIP-seq
MIRT2567165	hsa-miR-671-5p	CLIP-seq
MIRT2567166	hsa-miR-767-3p	CLIP-seq
MIRT2567167	hsa-miR-769-5p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
CREB5	Activation	21132541

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IDA	15850461
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0002224	Process	Toll-like receptor signaling pathway	IBA
GO:0002224	Process	Toll-like receptor signaling pathway	IEA
GO:0002224	Process	Toll-like receptor signaling pathway	ISS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	7799959
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	8774846, 15850461
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004683	Function	Calcium/calmodulin-dependent protein kinase activity	IBA
GO:0004708	Function	MAP kinase kinase activity	TAS	10781029
GO:0005515	Function	Protein binding	IPI	8774846, 21575178, 21988832, 23455922, 23487458, 23602568, 25241761, 25852190, 26496610, 28514442, 31515488, 31980649, 32707033, 33961781, 35271311
GO:0005516	Function	Calmodulin binding	IBA
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	10781029
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	TAS	8626550
GO:0009931	Function	Calcium-dependent protein serine/threonine kinase activity	IBA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032496	Process	Response to lipopolysaccharide	ISS
GO:0034097	Process	Response to cytokine	IBA
GO:0034097	Process	Response to cytokine	IDA	8774846
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0044351	Process	Macropinocytosis	IEA
GO:0044351	Process	Macropinocytosis	ISS
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0051019	Function	Mitogen-activated protein kinase binding	IBA
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
602130	6888	ENSG00000114738

Q16644

Protein name

MAP kinase-activated protein kinase 3 (MAPK-activated protein kinase 3) (MAPKAP kinase 3) (MAPKAP-K3) (MAPKAPK-3) (MK-3) (EC 2.7.11.1) (Chromosome 3p kinase) (3pK)

Protein function

Stress-activated serine/threonine-protein kinase involved in cytokines production, endocytosis, cell migration, chromatin remodeling and transcriptional regulation. Following stress, it is phosphorylated and activated by MAP kinase p38-alpha/MAP

PDB

3FHR , 3FXW , 3R1N , 3SHE , 7NRB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	44 → 304	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, with a higher expression level observed in heart and skeletal muscle. No expression in brain. Expressed in the retinal pigment epithelium (PubMed:26744326). {ECO:0000269|PubMed:26744326, ECO:0000269|PubMed:8622688, EC

Sequence

MDGETAEEQGGPVPPPVAPGGPGLGGAPGGRREPKKYAVTDDYQLSKQVLGLGVNGKVLE
CFHRRTGQKCALKLLYDSPKARQEVDHHWQASGGPHIVCILDVYENMHHGKRCLLIIMEC
MEGGELFSRIQERGDQAFTEREAAEIMRDIGTAIQFLHSHNIAHRDVKPENLLYTSKEKD
AVLKLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGFP
PFYSNTGQAISPGMKRRIRLGQYGFPNPEWSEVSEDAKQLIRLLLKTDPTERLTITQFMN
HPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNR
LLNKRRKKQAGSSSASQGCNNQ

Sequence length

382

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway VEGF signaling pathway		p38MAPK events Oxidative Stress Induced Senescence VEGFA-VEGFR2 Pathway activated TAK1 mediates p38 MAPK activation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Patterned macular dystrophy 3	Pathogenic	rs886037913	RCV000240674	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BUTTERFLY-SHAPED PIGMENTARY MACULAR DYSTROPHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR DYSTROPHY, PATTERNED, 3	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAPKAPK3-related disorder	Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PATTERNED DYSTROPHY OF RETINAL PIGMENT EPITHELIUM	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA 1	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	33523907	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26988419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophoderma maculatum	Anetoderma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	35306338	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31309477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19638618, 22465712, 34476575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	21061152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35285415	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	30212930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31494269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Dystrophy, Butterfly-Shaped Pigmentary, 2	Macular dystrophy, patterned	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
MACULAR DYSTROPHY, PATTERNED, 3	Macular dystrophy, patterned	ORPHANET_DG	26744326		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR DYSTROPHY, PATTERNED, 3	Macular dystrophy, patterned	UNIPROT_DG	26744326		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR DYSTROPHY, PATTERNED, 3	Macular dystrophy, patterned	BEFREE	27474146		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Martinique crinkled retinal pigment epitheliopathy	Macular dystrophy, patterned	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Patterned dystrophy of retinal pigment epithelium	Patterned Dystrophy Of Retinal Pigment Epithelium	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Porphyria Cutanea Tarda	Porphyria cutanea tarda	Pubtator	34476575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	26744326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rod-Cone Dystrophy	Rod-cone dystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	8622688	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37569854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	21132541		★★★★★ ★☆☆☆☆ Found in Text Mining only

MAPKAPK3 (MAPK activated protein kinase 3)