SCG2 (secretogranin II)

Gene

• Entrez ID: 7857
• Gene name: Secretogranin II
• Gene symbol: SCG2
• Synonyms (NCBI Gene): CHGC, EM66, SN, SgII
• Chromosome: 2
• Chromosome location: 2q36.1
• Summary: The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest that the full-length protein, secretogranin II, is involved in the packaging or sorting of peptide hormo

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT027788	hsa-miR-98-5p	Microarray	19088304
MIRT1329308	hsa-miR-3147	CLIP-seq
MIRT1329309	hsa-miR-409-3p	CLIP-seq
MIRT1329310	hsa-miR-4425	CLIP-seq
MIRT1329311	hsa-miR-450b-3p	CLIP-seq
MIRT1329312	hsa-miR-4709-3p	CLIP-seq
MIRT1329313	hsa-miR-4781-3p	CLIP-seq
MIRT1329314	hsa-miR-505	CLIP-seq
MIRT1329315	hsa-miR-539	CLIP-seq
MIRT1329316	hsa-miR-603	CLIP-seq
MIRT1329317	hsa-miR-769-3p	CLIP-seq
MIRT2618317	hsa-miR-1273e	CLIP-seq
MIRT2618318	hsa-miR-2355-5p	CLIP-seq
MIRT2618319	hsa-miR-3125	CLIP-seq
MIRT2618320	hsa-miR-3143	CLIP-seq
MIRT1329308	hsa-miR-3147	CLIP-seq
MIRT2618321	hsa-miR-3646	CLIP-seq
MIRT2618322	hsa-miR-3661	CLIP-seq
MIRT2618323	hsa-miR-376a	CLIP-seq
MIRT2618324	hsa-miR-376b	CLIP-seq
MIRT2618325	hsa-miR-3916	CLIP-seq
MIRT2618326	hsa-miR-3941	CLIP-seq
MIRT1329309	hsa-miR-409-3p	CLIP-seq
MIRT2618327	hsa-miR-4257	CLIP-seq
MIRT1329310	hsa-miR-4425	CLIP-seq
MIRT1329311	hsa-miR-450b-3p	CLIP-seq
MIRT2618328	hsa-miR-4635	CLIP-seq
MIRT2618329	hsa-miR-4643	CLIP-seq
MIRT2618330	hsa-miR-4645-3p	CLIP-seq
MIRT2618331	hsa-miR-466	CLIP-seq
MIRT2618332	hsa-miR-4672	CLIP-seq
MIRT1329312	hsa-miR-4709-3p	CLIP-seq
MIRT2618333	hsa-miR-4729	CLIP-seq
MIRT2618334	hsa-miR-4731-3p	CLIP-seq
MIRT2618335	hsa-miR-4760-3p	CLIP-seq
MIRT2618336	hsa-miR-4771	CLIP-seq
MIRT1329313	hsa-miR-4781-3p	CLIP-seq
MIRT2618337	hsa-miR-4789-3p	CLIP-seq
MIRT2618338	hsa-miR-4801	CLIP-seq
MIRT2618339	hsa-miR-486-5p	CLIP-seq
MIRT2618340	hsa-miR-495	CLIP-seq
MIRT2618341	hsa-miR-499-3p	CLIP-seq
MIRT2618342	hsa-miR-499a-3p	CLIP-seq
MIRT1329314	hsa-miR-505	CLIP-seq
MIRT2618343	hsa-miR-526b	CLIP-seq
MIRT1329315	hsa-miR-539	CLIP-seq
MIRT2618344	hsa-miR-543	CLIP-seq
MIRT2618345	hsa-miR-548ac	CLIP-seq
MIRT2618346	hsa-miR-548ae	CLIP-seq
MIRT2618347	hsa-miR-548aj	CLIP-seq
MIRT2618348	hsa-miR-548am	CLIP-seq
MIRT2618349	hsa-miR-548d-3p	CLIP-seq
MIRT2618350	hsa-miR-548x	CLIP-seq
MIRT2618351	hsa-miR-548z	CLIP-seq
MIRT2618352	hsa-miR-578	CLIP-seq
MIRT2618353	hsa-miR-582-5p	CLIP-seq
MIRT1329316	hsa-miR-603	CLIP-seq
MIRT2618354	hsa-miR-631	CLIP-seq
MIRT1329317	hsa-miR-769-3p	CLIP-seq
MIRT2618355	hsa-miR-802	CLIP-seq
MIRT2618318	hsa-miR-2355-5p	CLIP-seq
MIRT2618322	hsa-miR-3661	CLIP-seq
MIRT2618323	hsa-miR-376a	CLIP-seq
MIRT2618324	hsa-miR-376b	CLIP-seq
MIRT2618328	hsa-miR-4635	CLIP-seq
MIRT2618330	hsa-miR-4645-3p	CLIP-seq
MIRT1329312	hsa-miR-4709-3p	CLIP-seq
MIRT2618333	hsa-miR-4729	CLIP-seq
MIRT2618335	hsa-miR-4760-3p	CLIP-seq
MIRT2618339	hsa-miR-486-5p	CLIP-seq
MIRT2618340	hsa-miR-495	CLIP-seq
MIRT2618341	hsa-miR-499-3p	CLIP-seq
MIRT2618342	hsa-miR-499a-3p	CLIP-seq
MIRT1329314	hsa-miR-505	CLIP-seq
MIRT2618343	hsa-miR-526b	CLIP-seq
MIRT2618345	hsa-miR-548ac	CLIP-seq
MIRT2618346	hsa-miR-548ae	CLIP-seq
MIRT2618347	hsa-miR-548aj	CLIP-seq
MIRT2618348	hsa-miR-548am	CLIP-seq
MIRT2618349	hsa-miR-548d-3p	CLIP-seq
MIRT2618350	hsa-miR-548x	CLIP-seq
MIRT2618351	hsa-miR-548z	CLIP-seq
MIRT2618352	hsa-miR-578	CLIP-seq
MIRT2618353	hsa-miR-582-5p	CLIP-seq
MIRT1329316	hsa-miR-603	CLIP-seq
MIRT2618354	hsa-miR-631	CLIP-seq
MIRT2618355	hsa-miR-802	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IDA	14970115
GO:0001525	Process	Angiogenesis	IBA
GO:0001525	Process	Angiogenesis	IDA	14970115
GO:0001525	Process	Angiogenesis	IEA
GO:0001937	Process	Negative regulation of endothelial cell proliferation	TAS	9473216
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	14970115
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	14970115
GO:0005515	Function	Protein binding	IPI	19357184, 21516116, 25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9473216
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0006954	Process	Inflammatory response	TAS	14970115
GO:0009306	Process	Protein secretion	TAS	2745426
GO:0030141	Component	Secretory granule	IBA
GO:0030141	Component	Secretory granule	IEA
GO:0031045	Component	Dense core granule	IEA
GO:0035556	Process	Intracellular signal transduction	IDA	9473216
GO:0042056	Function	Chemoattractant activity	IBA
GO:0042056	Function	Chemoattractant activity	IDA	9473216
GO:0043542	Process	Endothelial cell migration	TAS	9473216
GO:0048245	Process	Eosinophil chemotaxis	IBA
GO:0048245	Process	Eosinophil chemotaxis	IDA	9473216
GO:0050918	Process	Positive chemotaxis	IDA	9473216
GO:0050930	Process	Induction of positive chemotaxis	IDA	9473216
GO:0098992	Component	Neuronal dense core vesicle	IEA
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IDA	14970115
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IDA	14970115

Other IDs

• MIM: 118930
• HGNC: 10575
• e!Ensembl: ENSG00000171951

Protein

• UniProt ID: P13521
• Protein name: Secretogranin-2 (Chromogranin-C) (Secretogranin II) (SgII) [Cleaved into: Secretoneurin (SN); Manserin]
• Protein function: Neuroendocrine protein of the granin family that regulates the biogenesis of secretory granules.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01271	Granin	27 → 614	Granin (chromogranin or secretogranin)	Family

• Sequence:

  MAEAKTHWLGAALSLIPLIFLISGAEAASFQRNQLLQKEPDLRLENVQKFPSPEMIRALE
  YIENLRQQAHKEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQ
  AENEPQSAPKENKPYALNSEKNFPMDMSDDYETQQWPERKLKHMQFPPMYEENSRDNPFK
  RTNEIVEEQYTPQSLATLESVFQELGKLTGPNNQKRERMDEEQKLYTDDEDDIYKANNIA
  YEDVVGGEDWNPVEEKIESQTQEEVRDSKENIEKNEQINDEMKRSGQLGIQEEDLRKESK
  DQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERATRLFEKPLDSQSIYQLIEISRNLQI
  PPEDLIEMLKTGEKPNGSVEPERELDLPVDLDDISEADLDHPDLFQNRMLSKSGYPKTPG
  RAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPK
  AAWIPHVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEDDLQEE
  EQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQE
  KAEKGREHIAKRAMENM

• Sequence length: 617

Pathways

Reactome:

Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	9465942		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	9100282		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	17102122, 22217803		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	18721831		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30690892		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	31228433		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	35341274, 36199424	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25377726		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25377726		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	22217803		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35793235, 36936167	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36057262	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	22136669		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	22136669	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	16101435		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36910014	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35844556, 35941638	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	22655045		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	16101435, 25377726, 28167285, 29337195, 29913555		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	16101435		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	16101435		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11036828		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23918206		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23918206		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	29913555		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	38035102	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	7591294		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	40065401	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	22655045		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	25377726		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	17584765, 21104344	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	17584765		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	17584765		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	32552841	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22217803		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24558503		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24558503	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	9681841		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	17953655	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	22655045, 23081990, 25377726		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	23081990, 25377726, 28167285, 29337195, 29913555		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16101435, 28442394, 30853937, 9100282, 9215690, 9465942, 9646033		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	1342949, 18239671, 2365053, 9646033		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	1342962, 9646033		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Neuroectodermal Tumors	BEFREE	1342962		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	22217803, 9100282		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	38423139	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	LHGDN	12788858		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	17102122, 22217803		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	30853937		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	12944418		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	30730440, 31228433		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11036828		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	1342962		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	31545397	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29481425		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33048468	Associate	★☆☆☆☆ Found in Text Mining only