FZD5 (frizzled class receptor 5)

Gene

• Entrez ID: 7855
• Gene name: Frizzled class receptor 5
• Gene symbol: FZD5
• Synonyms (NCBI Gene): C2orf31, HFZ5, MCOPCB11
• Chromosome: 2
• Chromosome location: 2q33.3
• Summary: Members of the `frizzled` gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030330	hsa-miR-26b-5p	Microarray	19088304
MIRT030625	hsa-miR-24-3p	Sequencing	20371350
MIRT045455	hsa-miR-149-5p	CLASH	23622248
MIRT523606	hsa-miR-374b-5p	HITS-CLIP	21572407
MIRT523605	hsa-miR-369-3p	HITS-CLIP	21572407
MIRT523604	hsa-miR-374a-5p	HITS-CLIP	21572407
MIRT523603	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT523601	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT523600	hsa-miR-5692b	HITS-CLIP	21572407
MIRT523599	hsa-miR-5692c	HITS-CLIP	21572407
MIRT523598	hsa-miR-300	HITS-CLIP	21572407
MIRT523597	hsa-miR-381-3p	HITS-CLIP	21572407
MIRT523596	hsa-miR-4666a-3p	HITS-CLIP	21572407
MIRT523595	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT523594	hsa-miR-656-3p	HITS-CLIP	21572407
MIRT523593	hsa-let-7a-3p	HITS-CLIP	21572407
MIRT523592	hsa-let-7b-3p	HITS-CLIP	21572407
MIRT523591	hsa-let-7f-1-3p	HITS-CLIP	21572407
MIRT523590	hsa-miR-98-3p	HITS-CLIP	21572407
MIRT523589	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT523588	hsa-miR-3924	HITS-CLIP	21572407
MIRT570688	hsa-miR-595	PAR-CLIP	20371350
MIRT570687	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT570686	hsa-miR-520h	PAR-CLIP	20371350
MIRT570685	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT570684	hsa-miR-548aw	PAR-CLIP	20371350
MIRT570683	hsa-miR-518a-5p	PAR-CLIP	20371350
MIRT570682	hsa-miR-527	PAR-CLIP	20371350
MIRT570680	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT570681	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT537300	hsa-miR-148a-3p	PAR-CLIP	22012620
MIRT537299	hsa-miR-148b-3p	PAR-CLIP	22012620
MIRT537298	hsa-miR-152-3p	PAR-CLIP	22012620
MIRT537297	hsa-miR-4670-3p	PAR-CLIP	22012620
MIRT537296	hsa-miR-4693-3p	PAR-CLIP	22012620
MIRT537295	hsa-miR-3611	PAR-CLIP	22012620
MIRT537294	hsa-miR-8055	PAR-CLIP	22012620
MIRT523606	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT523605	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT523604	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT523603	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT523602	hsa-miR-216b-5p	PAR-CLIP	23446348
MIRT523601	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT523600	hsa-miR-5692b	PAR-CLIP	23446348
MIRT523599	hsa-miR-5692c	PAR-CLIP	23446348
MIRT523598	hsa-miR-300	PAR-CLIP	23446348
MIRT523597	hsa-miR-381-3p	PAR-CLIP	23446348
MIRT523596	hsa-miR-4666a-3p	PAR-CLIP	23446348
MIRT523595	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT523594	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT523593	hsa-let-7a-3p	PAR-CLIP	23446348
MIRT523592	hsa-let-7b-3p	PAR-CLIP	23446348
MIRT523591	hsa-let-7f-1-3p	PAR-CLIP	23446348
MIRT523590	hsa-miR-98-3p	PAR-CLIP	23446348
MIRT523589	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT523588	hsa-miR-3924	PAR-CLIP	23446348
MIRT447278	hsa-miR-7-1-3p	PAR-CLIP	22100165
MIRT447277	hsa-miR-7-2-3p	PAR-CLIP	22100165
MIRT447276	hsa-miR-3065-5p	PAR-CLIP	22100165
MIRT447275	hsa-miR-873-3p	PAR-CLIP	22100165
MIRT447274	hsa-miR-505-3p	PAR-CLIP	22100165
MIRT447273	hsa-miR-7159-5p	PAR-CLIP	22100165
MIRT447271	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT447272	hsa-miR-3672	PAR-CLIP	22100165
MIRT447270	hsa-miR-6864-3p	PAR-CLIP	22100165
MIRT447278	hsa-miR-7-1-3p	PAR-CLIP	22100165
MIRT447277	hsa-miR-7-2-3p	PAR-CLIP	22100165
MIRT447276	hsa-miR-3065-5p	PAR-CLIP	22100165
MIRT447275	hsa-miR-873-3p	PAR-CLIP	22100165
MIRT447274	hsa-miR-505-3p	PAR-CLIP	22100165
MIRT447273	hsa-miR-7159-5p	PAR-CLIP	22100165
MIRT447271	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT447272	hsa-miR-3672	PAR-CLIP	22100165
MIRT447270	hsa-miR-6864-3p	PAR-CLIP	22100165
MIRT242970	hsa-miR-23a-3p	qRT-PCR, Microarray, Western blot	25422915
MIRT737082	hsa-miR-934	Luciferase reporter assay, Western blotting, qRT-PCR	32459171
MIRT523606	hsa-miR-374b-5p	HITS-CLIP	21572407
MIRT523605	hsa-miR-369-3p	HITS-CLIP	21572407
MIRT523604	hsa-miR-374a-5p	HITS-CLIP	21572407
MIRT523603	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT523601	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT523600	hsa-miR-5692b	HITS-CLIP	21572407
MIRT523599	hsa-miR-5692c	HITS-CLIP	21572407
MIRT523598	hsa-miR-300	HITS-CLIP	21572407
MIRT523597	hsa-miR-381-3p	HITS-CLIP	21572407
MIRT523596	hsa-miR-4666a-3p	HITS-CLIP	21572407
MIRT523595	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT523594	hsa-miR-656-3p	HITS-CLIP	21572407
MIRT523593	hsa-let-7a-3p	HITS-CLIP	21572407
MIRT523592	hsa-let-7b-3p	HITS-CLIP	21572407
MIRT523591	hsa-let-7f-1-3p	HITS-CLIP	21572407
MIRT523590	hsa-miR-98-3p	HITS-CLIP	21572407
MIRT523589	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT523588	hsa-miR-3924	HITS-CLIP	21572407
MIRT570688	hsa-miR-595	PAR-CLIP	20371350
MIRT570687	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT570686	hsa-miR-520h	PAR-CLIP	20371350
MIRT570685	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT570684	hsa-miR-548aw	PAR-CLIP	20371350
MIRT570683	hsa-miR-518a-5p	PAR-CLIP	20371350
MIRT570682	hsa-miR-527	PAR-CLIP	20371350
MIRT570680	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT570681	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT537300	hsa-miR-148a-3p	PAR-CLIP	22012620
MIRT537299	hsa-miR-148b-3p	PAR-CLIP	22012620
MIRT537298	hsa-miR-152-3p	PAR-CLIP	22012620
MIRT537297	hsa-miR-4670-3p	PAR-CLIP	22012620
MIRT537296	hsa-miR-4693-3p	PAR-CLIP	22012620
MIRT537295	hsa-miR-3611	PAR-CLIP	22012620
MIRT537294	hsa-miR-8055	PAR-CLIP	22012620
MIRT523606	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT523605	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT523604	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT523603	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT523602	hsa-miR-216b-5p	PAR-CLIP	23446348
MIRT523601	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT523600	hsa-miR-5692b	PAR-CLIP	23446348
MIRT523599	hsa-miR-5692c	PAR-CLIP	23446348
MIRT523598	hsa-miR-300	PAR-CLIP	23446348
MIRT523597	hsa-miR-381-3p	PAR-CLIP	23446348
MIRT523596	hsa-miR-4666a-3p	PAR-CLIP	23446348
MIRT523595	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT523594	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT523593	hsa-let-7a-3p	PAR-CLIP	23446348
MIRT523592	hsa-let-7b-3p	PAR-CLIP	23446348
MIRT523591	hsa-let-7f-1-3p	PAR-CLIP	23446348
MIRT523590	hsa-miR-98-3p	PAR-CLIP	23446348
MIRT523589	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT523588	hsa-miR-3924	PAR-CLIP	23446348
MIRT447278	hsa-miR-7-1-3p	PAR-CLIP	22100165
MIRT447277	hsa-miR-7-2-3p	PAR-CLIP	22100165
MIRT447276	hsa-miR-3065-5p	PAR-CLIP	22100165
MIRT447275	hsa-miR-873-3p	PAR-CLIP	22100165
MIRT447274	hsa-miR-505-3p	PAR-CLIP	22100165
MIRT447273	hsa-miR-7159-5p	PAR-CLIP	22100165
MIRT447271	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT447272	hsa-miR-3672	PAR-CLIP	22100165
MIRT447270	hsa-miR-6864-3p	PAR-CLIP	22100165
MIRT447278	hsa-miR-7-1-3p	PAR-CLIP	22100165
MIRT447277	hsa-miR-7-2-3p	PAR-CLIP	22100165
MIRT447276	hsa-miR-3065-5p	PAR-CLIP	22100165
MIRT447275	hsa-miR-873-3p	PAR-CLIP	22100165
MIRT447274	hsa-miR-505-3p	PAR-CLIP	22100165
MIRT447273	hsa-miR-7159-5p	PAR-CLIP	22100165
MIRT447271	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT447272	hsa-miR-3672	PAR-CLIP	22100165
MIRT447270	hsa-miR-6864-3p	PAR-CLIP	22100165
MIRT030625	hsa-miR-24-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP)	37575527
MIRT1008332	hsa-let-7a	CLIP-seq
MIRT1008333	hsa-let-7b	CLIP-seq
MIRT1008334	hsa-let-7c	CLIP-seq
MIRT1008335	hsa-let-7d	CLIP-seq
MIRT1008336	hsa-let-7e	CLIP-seq
MIRT1008337	hsa-let-7f	CLIP-seq
MIRT1008338	hsa-let-7g	CLIP-seq
MIRT1008339	hsa-let-7i	CLIP-seq
MIRT1008340	hsa-miR-100	CLIP-seq
MIRT1008341	hsa-miR-1255a	CLIP-seq
MIRT1008342	hsa-miR-1255b	CLIP-seq
MIRT1008343	hsa-miR-1260	CLIP-seq
MIRT1008344	hsa-miR-1260b	CLIP-seq
MIRT1008345	hsa-miR-1827	CLIP-seq
MIRT1008346	hsa-miR-188-3p	CLIP-seq
MIRT1008347	hsa-miR-1915	CLIP-seq
MIRT1008348	hsa-miR-203	CLIP-seq
MIRT1008349	hsa-miR-2278	CLIP-seq
MIRT1008350	hsa-miR-24	CLIP-seq
MIRT1008351	hsa-miR-2467-3p	CLIP-seq
MIRT1008352	hsa-miR-3064-5p	CLIP-seq
MIRT1008353	hsa-miR-3119	CLIP-seq
MIRT1008354	hsa-miR-3120-5p	CLIP-seq
MIRT1008355	hsa-miR-3126-5p	CLIP-seq
MIRT1008356	hsa-miR-3130-3p	CLIP-seq
MIRT1008357	hsa-miR-3136-5p	CLIP-seq
MIRT1008358	hsa-miR-3156-3p	CLIP-seq
MIRT1008359	hsa-miR-3192	CLIP-seq
MIRT1008360	hsa-miR-329	CLIP-seq
MIRT1008361	hsa-miR-342-3p	CLIP-seq
MIRT1008362	hsa-miR-3612	CLIP-seq
MIRT1008363	hsa-miR-3617	CLIP-seq
MIRT1008364	hsa-miR-3618	CLIP-seq
MIRT1008365	hsa-miR-3622a-3p	CLIP-seq
MIRT1008366	hsa-miR-3622b-3p	CLIP-seq
MIRT1008367	hsa-miR-362-3p	CLIP-seq
MIRT1008368	hsa-miR-3665	CLIP-seq
MIRT1008369	hsa-miR-3714	CLIP-seq
MIRT1008370	hsa-miR-374a	CLIP-seq
MIRT1008371	hsa-miR-374b	CLIP-seq
MIRT1008372	hsa-miR-374c	CLIP-seq
MIRT1008373	hsa-miR-383	CLIP-seq
MIRT1008374	hsa-miR-3941	CLIP-seq
MIRT1008375	hsa-miR-3974	CLIP-seq
MIRT1008376	hsa-miR-3976	CLIP-seq
MIRT1008377	hsa-miR-4252	CLIP-seq
MIRT1008378	hsa-miR-4257	CLIP-seq
MIRT1008379	hsa-miR-4274	CLIP-seq
MIRT1008380	hsa-miR-4275	CLIP-seq
MIRT1008381	hsa-miR-4278	CLIP-seq
MIRT1008382	hsa-miR-4282	CLIP-seq
MIRT1008383	hsa-miR-4284	CLIP-seq
MIRT1008384	hsa-miR-4314	CLIP-seq
MIRT1008385	hsa-miR-433	CLIP-seq
MIRT1008386	hsa-miR-4417	CLIP-seq
MIRT1008387	hsa-miR-4419a	CLIP-seq
MIRT1008388	hsa-miR-4422	CLIP-seq
MIRT1008389	hsa-miR-4439	CLIP-seq
MIRT1008390	hsa-miR-4458	CLIP-seq
MIRT1008391	hsa-miR-4459	CLIP-seq
MIRT1008392	hsa-miR-4493	CLIP-seq
MIRT1008393	hsa-miR-4500	CLIP-seq
MIRT1008394	hsa-miR-4510	CLIP-seq
MIRT1008395	hsa-miR-4513	CLIP-seq
MIRT1008396	hsa-miR-455-5p	CLIP-seq
MIRT1008397	hsa-miR-4646-5p	CLIP-seq
MIRT1008398	hsa-miR-4649-3p	CLIP-seq
MIRT1008399	hsa-miR-466	CLIP-seq
MIRT1008400	hsa-miR-4660	CLIP-seq
MIRT1008401	hsa-miR-4662a-5p	CLIP-seq
MIRT1008402	hsa-miR-4668-5p	CLIP-seq
MIRT1008403	hsa-miR-4672	CLIP-seq
MIRT1008404	hsa-miR-4684-5p	CLIP-seq
MIRT1008405	hsa-miR-4690-3p	CLIP-seq
MIRT1008406	hsa-miR-4695-5p	CLIP-seq
MIRT1008407	hsa-miR-4698	CLIP-seq
MIRT1008408	hsa-miR-4719	CLIP-seq
MIRT1008409	hsa-miR-4724-3p	CLIP-seq
MIRT1008410	hsa-miR-4726-3p	CLIP-seq
MIRT1008411	hsa-miR-4727-5p	CLIP-seq
MIRT1008412	hsa-miR-4747-5p	CLIP-seq
MIRT1008413	hsa-miR-4758-3p	CLIP-seq
MIRT1008414	hsa-miR-4761-5p	CLIP-seq
MIRT1008415	hsa-miR-4762-3p	CLIP-seq
MIRT1008416	hsa-miR-4769-3p	CLIP-seq
MIRT1008417	hsa-miR-4772-5p	CLIP-seq
MIRT1008418	hsa-miR-4797-3p	CLIP-seq
MIRT1008419	hsa-miR-4798-5p	CLIP-seq
MIRT1008420	hsa-miR-4803	CLIP-seq
MIRT1008421	hsa-miR-520d-5p	CLIP-seq
MIRT1008422	hsa-miR-524-5p	CLIP-seq
MIRT1008423	hsa-miR-541	CLIP-seq
MIRT1008424	hsa-miR-548a-5p	CLIP-seq
MIRT1008425	hsa-miR-548ab	CLIP-seq
MIRT1008426	hsa-miR-548ae	CLIP-seq
MIRT1008427	hsa-miR-548aj	CLIP-seq
MIRT1008428	hsa-miR-548ak	CLIP-seq
MIRT1008429	hsa-miR-548am	CLIP-seq
MIRT1008430	hsa-miR-548b-5p	CLIP-seq
MIRT1008431	hsa-miR-548c-5p	CLIP-seq
MIRT1008432	hsa-miR-548d-5p	CLIP-seq
MIRT1008433	hsa-miR-548h	CLIP-seq
MIRT1008434	hsa-miR-548i	CLIP-seq
MIRT1008435	hsa-miR-548j	CLIP-seq
MIRT1008436	hsa-miR-548k	CLIP-seq
MIRT1008437	hsa-miR-548l	CLIP-seq
MIRT1008438	hsa-miR-548w	CLIP-seq
MIRT1008439	hsa-miR-548x	CLIP-seq
MIRT1008440	hsa-miR-548y	CLIP-seq
MIRT1008441	hsa-miR-550a	CLIP-seq
MIRT1008442	hsa-miR-559	CLIP-seq
MIRT1008443	hsa-miR-579	CLIP-seq
MIRT1008444	hsa-miR-593	CLIP-seq
MIRT1008445	hsa-miR-603	CLIP-seq
MIRT1008446	hsa-miR-622	CLIP-seq
MIRT1008447	hsa-miR-641	CLIP-seq
MIRT1008448	hsa-miR-650	CLIP-seq
MIRT1008449	hsa-miR-654-5p	CLIP-seq
MIRT1008450	hsa-miR-655	CLIP-seq
MIRT1008451	hsa-miR-657	CLIP-seq
MIRT1008452	hsa-miR-665	CLIP-seq
MIRT1008453	hsa-miR-7	CLIP-seq
MIRT1008454	hsa-miR-766	CLIP-seq
MIRT1008455	hsa-miR-767-5p	CLIP-seq
MIRT1008456	hsa-miR-873	CLIP-seq
MIRT1008457	hsa-miR-922	CLIP-seq
MIRT1008458	hsa-miR-98	CLIP-seq
MIRT1008459	hsa-miR-99a	CLIP-seq
MIRT1008460	hsa-miR-99b	CLIP-seq
MIRT1998724	hsa-miR-1266	CLIP-seq
MIRT1998725	hsa-miR-1273g	CLIP-seq
MIRT1998726	hsa-miR-1298	CLIP-seq
MIRT1998727	hsa-miR-146a	CLIP-seq
MIRT1998728	hsa-miR-146b-5p	CLIP-seq
MIRT1008345	hsa-miR-1827	CLIP-seq
MIRT1008347	hsa-miR-1915	CLIP-seq
MIRT1008349	hsa-miR-2278	CLIP-seq
MIRT1008351	hsa-miR-2467-3p	CLIP-seq
MIRT1008352	hsa-miR-3064-5p	CLIP-seq
MIRT1008354	hsa-miR-3120-5p	CLIP-seq
MIRT1998729	hsa-miR-3121-3p	CLIP-seq
MIRT1998730	hsa-miR-3125	CLIP-seq
MIRT1008357	hsa-miR-3136-5p	CLIP-seq
MIRT1998731	hsa-miR-3140-3p	CLIP-seq
MIRT1998732	hsa-miR-3155	CLIP-seq
MIRT1998733	hsa-miR-3155b	CLIP-seq
MIRT1998734	hsa-miR-3170	CLIP-seq
MIRT1998735	hsa-miR-3180-5p	CLIP-seq
MIRT1998736	hsa-miR-3187-3p	CLIP-seq
MIRT1998737	hsa-miR-3188	CLIP-seq
MIRT1998738	hsa-miR-3190	CLIP-seq
MIRT1008359	hsa-miR-3192	CLIP-seq
MIRT1998739	hsa-miR-3194-3p	CLIP-seq
MIRT1998740	hsa-miR-3202	CLIP-seq
MIRT1998741	hsa-miR-320e	CLIP-seq
MIRT1998742	hsa-miR-326	CLIP-seq
MIRT1998743	hsa-miR-330-5p	CLIP-seq
MIRT1998744	hsa-miR-34b	CLIP-seq
MIRT1998745	hsa-miR-3609	CLIP-seq
MIRT1008363	hsa-miR-3617	CLIP-seq
MIRT1008364	hsa-miR-3618	CLIP-seq
MIRT1998746	hsa-miR-3664-3p	CLIP-seq
MIRT1998747	hsa-miR-3685	CLIP-seq
MIRT1008369	hsa-miR-3714	CLIP-seq
MIRT1998748	hsa-miR-384	CLIP-seq
MIRT1998749	hsa-miR-3916	CLIP-seq
MIRT1008378	hsa-miR-4257	CLIP-seq
MIRT1998750	hsa-miR-4261	CLIP-seq
MIRT1998751	hsa-miR-4263	CLIP-seq
MIRT1998752	hsa-miR-4269	CLIP-seq
MIRT1008379	hsa-miR-4274	CLIP-seq
MIRT1008382	hsa-miR-4282	CLIP-seq
MIRT1998753	hsa-miR-4283	CLIP-seq
MIRT1998754	hsa-miR-4301	CLIP-seq
MIRT1008384	hsa-miR-4314	CLIP-seq
MIRT1998755	hsa-miR-4418	CLIP-seq
MIRT1998756	hsa-miR-4428	CLIP-seq
MIRT1998757	hsa-miR-4434	CLIP-seq
MIRT1998758	hsa-miR-4438	CLIP-seq
MIRT1008389	hsa-miR-4439	CLIP-seq
MIRT1998759	hsa-miR-4455	CLIP-seq
MIRT1998760	hsa-miR-4489	CLIP-seq
MIRT1998761	hsa-miR-4503	CLIP-seq
MIRT1008395	hsa-miR-4513	CLIP-seq
MIRT1998762	hsa-miR-4514	CLIP-seq
MIRT1998763	hsa-miR-4516	CLIP-seq
MIRT1998764	hsa-miR-4518	CLIP-seq
MIRT1998765	hsa-miR-4519	CLIP-seq
MIRT1998766	hsa-miR-4529-5p	CLIP-seq
MIRT1998767	hsa-miR-4533	CLIP-seq
MIRT1008397	hsa-miR-4646-5p	CLIP-seq
MIRT1998768	hsa-miR-4667-5p	CLIP-seq
MIRT1998769	hsa-miR-4692	CLIP-seq
MIRT1008407	hsa-miR-4698	CLIP-seq
MIRT1998770	hsa-miR-4700-5p	CLIP-seq
MIRT1008410	hsa-miR-4726-3p	CLIP-seq
MIRT1008411	hsa-miR-4727-5p	CLIP-seq
MIRT1998771	hsa-miR-4742-5p	CLIP-seq
MIRT1008412	hsa-miR-4747-5p	CLIP-seq
MIRT1998772	hsa-miR-4773	CLIP-seq
MIRT1998773	hsa-miR-4778-3p	CLIP-seq
MIRT1998774	hsa-miR-4778-5p	CLIP-seq
MIRT1008420	hsa-miR-4803	CLIP-seq
MIRT1998775	hsa-miR-484	CLIP-seq
MIRT1998776	hsa-miR-498	CLIP-seq
MIRT1998777	hsa-miR-509-3-5p	CLIP-seq
MIRT1998778	hsa-miR-5095	CLIP-seq
MIRT1998779	hsa-miR-509-5p	CLIP-seq
MIRT1998780	hsa-miR-510	CLIP-seq
MIRT1008426	hsa-miR-548ae	CLIP-seq
MIRT1998781	hsa-miR-548ah	CLIP-seq
MIRT1008427	hsa-miR-548aj	CLIP-seq
MIRT1008429	hsa-miR-548am	CLIP-seq
MIRT1998782	hsa-miR-548g	CLIP-seq
MIRT1008439	hsa-miR-548x	CLIP-seq
MIRT1998783	hsa-miR-576-5p	CLIP-seq
MIRT1998784	hsa-miR-589	CLIP-seq
MIRT1998785	hsa-miR-590-3p	CLIP-seq
MIRT1998786	hsa-miR-605	CLIP-seq
MIRT1998787	hsa-miR-609	CLIP-seq
MIRT1998788	hsa-miR-621	CLIP-seq
MIRT1008446	hsa-miR-622	CLIP-seq
MIRT1998789	hsa-miR-629	CLIP-seq
MIRT1998790	hsa-miR-637	CLIP-seq
MIRT1008447	hsa-miR-641	CLIP-seq
MIRT1008453	hsa-miR-7	CLIP-seq
MIRT1008455	hsa-miR-767-5p	CLIP-seq
MIRT1008456	hsa-miR-873	CLIP-seq
MIRT1008457	hsa-miR-922	CLIP-seq
MIRT1998791	hsa-miR-924	CLIP-seq
MIRT1998792	hsa-miR-944	CLIP-seq
MIRT2232448	hsa-miR-1185	CLIP-seq
MIRT2232449	hsa-miR-1208	CLIP-seq
MIRT2232450	hsa-miR-1225-5p	CLIP-seq
MIRT2232451	hsa-miR-1226	CLIP-seq
MIRT2232452	hsa-miR-1229	CLIP-seq
MIRT2232453	hsa-miR-1290	CLIP-seq
MIRT2232454	hsa-miR-1299	CLIP-seq
MIRT2232455	hsa-miR-148a	CLIP-seq
MIRT2232456	hsa-miR-148b	CLIP-seq
MIRT2232457	hsa-miR-152	CLIP-seq
MIRT2232458	hsa-miR-1587	CLIP-seq
MIRT1008347	hsa-miR-1915	CLIP-seq
MIRT2232459	hsa-miR-200b	CLIP-seq
MIRT2232460	hsa-miR-200c	CLIP-seq
MIRT2232461	hsa-miR-22	CLIP-seq
MIRT1008349	hsa-miR-2278	CLIP-seq
MIRT2232462	hsa-miR-2355-5p	CLIP-seq
MIRT2232463	hsa-miR-23a	CLIP-seq
MIRT2232464	hsa-miR-23b	CLIP-seq
MIRT2232465	hsa-miR-23c	CLIP-seq
MIRT1008354	hsa-miR-3120-5p	CLIP-seq
MIRT1998729	hsa-miR-3121-3p	CLIP-seq
MIRT1998730	hsa-miR-3125	CLIP-seq
MIRT2232466	hsa-miR-3127-3p	CLIP-seq
MIRT1008356	hsa-miR-3130-3p	CLIP-seq
MIRT2232467	hsa-miR-3137	CLIP-seq
MIRT2232468	hsa-miR-3143	CLIP-seq
MIRT2232469	hsa-miR-3160-5p	CLIP-seq
MIRT2232470	hsa-miR-3167	CLIP-seq
MIRT2232471	hsa-miR-3189-3p	CLIP-seq
MIRT1008359	hsa-miR-3192	CLIP-seq
MIRT2232472	hsa-miR-320a	CLIP-seq
MIRT2232473	hsa-miR-320b	CLIP-seq
MIRT2232474	hsa-miR-320c	CLIP-seq
MIRT2232475	hsa-miR-320d	CLIP-seq
MIRT2232476	hsa-miR-330-3p	CLIP-seq
MIRT2232477	hsa-miR-331-3p	CLIP-seq
MIRT2232478	hsa-miR-342-5p	CLIP-seq
MIRT1008364	hsa-miR-3618	CLIP-seq
MIRT1008365	hsa-miR-3622a-3p	CLIP-seq
MIRT1008366	hsa-miR-3622b-3p	CLIP-seq
MIRT2232479	hsa-miR-3679-5p	CLIP-seq
MIRT2232480	hsa-miR-3686	CLIP-seq
MIRT1008369	hsa-miR-3714	CLIP-seq
MIRT1008372	hsa-miR-374c	CLIP-seq
MIRT1998749	hsa-miR-3916	CLIP-seq
MIRT2232481	hsa-miR-3919	CLIP-seq
MIRT2232482	hsa-miR-3942-3p	CLIP-seq
MIRT1008375	hsa-miR-3974	CLIP-seq
MIRT2232483	hsa-miR-4264	CLIP-seq
MIRT1008379	hsa-miR-4274	CLIP-seq
MIRT2232484	hsa-miR-429	CLIP-seq
MIRT2232485	hsa-miR-4292	CLIP-seq
MIRT1008384	hsa-miR-4314	CLIP-seq
MIRT1008385	hsa-miR-433	CLIP-seq
MIRT2232486	hsa-miR-4420	CLIP-seq
MIRT2232487	hsa-miR-4429	CLIP-seq
MIRT2232488	hsa-miR-4432	CLIP-seq
MIRT1998765	hsa-miR-4519	CLIP-seq
MIRT1008397	hsa-miR-4646-5p	CLIP-seq
MIRT2232489	hsa-miR-4651	CLIP-seq
MIRT2232490	hsa-miR-4652-3p	CLIP-seq
MIRT2232491	hsa-miR-4664-5p	CLIP-seq
MIRT2232492	hsa-miR-4674	CLIP-seq
MIRT2232493	hsa-miR-4695-3p	CLIP-seq
MIRT1008410	hsa-miR-4726-3p	CLIP-seq
MIRT2232494	hsa-miR-4732-5p	CLIP-seq
MIRT2232495	hsa-miR-4733-3p	CLIP-seq
MIRT2232496	hsa-miR-4756-3p	CLIP-seq
MIRT1008416	hsa-miR-4769-3p	CLIP-seq
MIRT2232497	hsa-miR-4782-5p	CLIP-seq
MIRT2232498	hsa-miR-4796-5p	CLIP-seq
MIRT1008418	hsa-miR-4797-3p	CLIP-seq
MIRT1008420	hsa-miR-4803	CLIP-seq
MIRT2232499	hsa-miR-499-5p	CLIP-seq
MIRT2232500	hsa-miR-516b	CLIP-seq
MIRT1008426	hsa-miR-548ae	CLIP-seq
MIRT1008427	hsa-miR-548aj	CLIP-seq
MIRT1008429	hsa-miR-548am	CLIP-seq
MIRT2232501	hsa-miR-548c-3p	CLIP-seq
MIRT1008439	hsa-miR-548x	CLIP-seq
MIRT2232502	hsa-miR-555	CLIP-seq
MIRT2232503	hsa-miR-608	CLIP-seq
MIRT1008446	hsa-miR-622	CLIP-seq
MIRT2232504	hsa-miR-635	CLIP-seq
MIRT1008450	hsa-miR-655	CLIP-seq
MIRT1008455	hsa-miR-767-5p	CLIP-seq
MIRT1008456	hsa-miR-873	CLIP-seq
MIRT2232505	hsa-miR-876-5p	CLIP-seq
MIRT2232506	hsa-miR-877	CLIP-seq
MIRT2388306	hsa-miR-4723-5p	CLIP-seq
MIRT2388307	hsa-miR-4728-5p	CLIP-seq
MIRT2437333	hsa-miR-125a-5p	CLIP-seq
MIRT2437334	hsa-miR-125b	CLIP-seq
MIRT2437335	hsa-miR-1291	CLIP-seq
MIRT2437336	hsa-miR-3670	CLIP-seq
MIRT2437337	hsa-miR-4319	CLIP-seq
MIRT2437338	hsa-miR-4528	CLIP-seq
MIRT2437333	hsa-miR-125a-5p	CLIP-seq
MIRT2437334	hsa-miR-125b	CLIP-seq
MIRT2437335	hsa-miR-1291	CLIP-seq
MIRT2437336	hsa-miR-3670	CLIP-seq
MIRT2437337	hsa-miR-4319	CLIP-seq
MIRT2437338	hsa-miR-4528	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000578	Process	Embryonic axis specification	IDA	12121999
GO:0001525	Process	Angiogenesis	IEA
GO:0001540	Function	Amyloid-beta binding	IPI	18234671
GO:0001540	Function	Amyloid-beta binding	TAS	24449494
GO:0001654	Process	Eye development	IMP	26908622
GO:0001944	Process	Vasculature development	IEA
GO:0002071	Process	Glandular epithelial cell maturation	IEA
GO:0002726	Process	Positive regulation of T cell cytokine production	IDA	16601243
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	18838381, 19643732, 22895187, 26908622, 29748286, 32296183
GO:0005769	Component	Early endosome	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15459103, 26908622
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005923	Component	Bicellular tight junction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007416	Process	Synapse assembly	TAS	24449494
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0008595	Process	Anterior/posterior axis specification, embryo	IDA	9054360
GO:0009986	Component	Cell surface	IDA	19643732
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0017147	Function	Wnt-protein binding	IBA
GO:0017147	Function	Wnt-protein binding	IDA	26908622
GO:0017147	Function	Wnt-protein binding	IEA
GO:0017147	Function	Wnt-protein binding	IPI	12490564, 12857724, 18174455
GO:0017147	Function	Wnt-protein binding	TAS	18234671
GO:0019901	Function	Protein kinase binding	IPI	19643732
GO:0030182	Process	Neuron differentiation	ISS
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031076	Process	Embryonic camera-type eye development	IEA
GO:0031077	Process	Post-embryonic camera-type eye development	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	22575959
GO:0031901	Component	Early endosome membrane	TAS
GO:0032729	Process	Positive regulation of type II interferon production	IMP	16601243
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0035567	Process	Non-canonical Wnt signaling pathway	IBA
GO:0035567	Process	Non-canonical Wnt signaling pathway	IDA	26908622
GO:0042813	Function	Wnt receptor activity	IBA
GO:0042813	Function	Wnt receptor activity	IC	9054360
GO:0042813	Function	Wnt receptor activity	IDA	15459103, 26908622, 28733458
GO:0042813	Function	Wnt receptor activity	IEA
GO:0042813	Function	Wnt receptor activity	TAS	24449494
GO:0042995	Component	Cell projection	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0044877	Function	Protein-containing complex binding	IPI	18234671
GO:0045202	Component	Synapse	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12857724
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	10906785
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048596	Process	Embryonic camera-type eye morphogenesis	IEA
GO:0048731	Process	System development	IEA
GO:0060061	Process	Spemann organizer formation	IDA	9054360
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	11029007, 12121999, 12857724, 15459103, 24080158, 26908622, 28733458
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IMP	9054360
GO:0060561	Process	Apoptotic process involved in morphogenesis	IEA
GO:0060574	Process	Intestinal epithelial cell maturation	IEA
GO:0060670	Process	Branching involved in labyrinthine layer morphogenesis	IEA
GO:0060715	Process	Syncytiotrophoblast cell differentiation involved in labyrinthine layer development	IEA
GO:0060716	Process	Labyrinthine layer blood vessel development	IEA
GO:0060718	Process	Chorionic trophoblast cell differentiation	IEA
GO:0071219	Process	Cellular response to molecule of bacterial origin	IDA	16601243
GO:1901382	Process	Regulation of chorionic trophoblast cell proliferation	IEA
GO:1901524	Process	Regulation of mitophagy	HMP	24912190
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	HMP	24912190
GO:2000810	Process	Regulation of bicellular tight junction assembly	IEA

Other IDs

• MIM: 601723
• HGNC: 4043
• e!Ensembl: ENSG00000163251

Protein

• UniProt ID: Q13467
• Protein name: Frizzled-5 (Fz-5) (hFz5) (FzE5)
• Protein function: Receptor for Wnt proteins (PubMed:10097073, PubMed:20530549, PubMed:26908622, PubMed:9054360). Functions in the canonical Wnt/beta-catenin signaling pathway. In vitro activates WNT2, WNT10B, WNT5A, but not WNT2B or WNT4 signaling (By similarity)
• PDB: 5URY, 5URZ, 6O39, 6WW2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01392	Fz	33 → 141	Fz domain	Domain
  PF01534	Frizzled	226 → 537	Frizzled/Smoothened family membrane region	Family

• Sequence:

  MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
  DEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
  RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGG
  ECPAGGPFVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSADERTFATFWIG
  LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
  EHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
  HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
  AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
  ALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCR
  PRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSHV

• Sequence length: 585

Pathways

KEGG:

mTOR signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Cushing syndrome
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Human papillomavirus infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Reactome:

Ca2+ pathway
Asymmetric localization of PCP proteins
Disassembly of the destruction complex and recruitment of AXIN to the membrane
Regulation of FZD by ubiquitination
WNT5A-dependent internalization of FZD2, FZD5 and ROR2
RNF mutants show enhanced WNT signaling and proliferation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Congenital ocular coloboma	Likely pathogenic; Pathogenic	rs2091986259, rs2091987023, rs2091988799	RCV001089479 RCV001089478 RCV001089477	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Microphthalmia/coloboma 11	Pathogenic; Likely pathogenic	rs2470339440, rs2470339052, rs750162817, rs2470337831, rs2470337909, rs2091986259	RCV003881723 RCV003881724 RCV003881726 RCV003881727 RCV003881728 RCV003882735	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BLADDER EXSTROPHY AND EPISPADIAS COMPLEX	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder exstrophy-epispadias-cloacal extrophy complex	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT EYELID	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOBOMA OF CHOROID AND RETINA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOBOMA OF LENS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOBOMA OF OPTIC DISC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL COLOBOMA OF IRIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FZD5-related disorder	Benign; Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoma	Adenoma	BEFREE	30622113		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	29533772		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27869803		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31534019		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	20376066	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10688908, 11315916	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31534019		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	30841855, 35328735	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25209439, 27323393, 27859262, 28215225		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25209439, 36001375	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15557753		★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	19874621	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15557753	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25861751	Associate	★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	31082802		★☆☆☆☆ Found in Text Mining only
Coloboma	Coloboma	Pubtator	32737437, 33633439, 36695497	Associate	★☆☆☆☆ Found in Text Mining only
Coloboma of choroid and retina	Coloboma Of Eye	ORPHANET_DG	26908622		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coloboma of lens	Lens coloboma	ORPHANET_DG	26908622		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coloboma of optic disc	Coloboma of optic disc	ORPHANET_DG	26908622		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon Carcinoma	Colon Carcinoma	BEFREE	25274627		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	29021137		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30555158, 30689807		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37595345	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital coloboma of iris	Congenital Coloboma Of Iris	ORPHANET_DG	26908622		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital ocular coloboma (disorder)	Congenital ocular coloboma	BEFREE	26908622		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25861751		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	21937024		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	30733609		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31726413		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	29477872		★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	36695497	Associate	★☆☆☆☆ Found in Text Mining only
Familial Exudative Vitreoretinopathy	Exudative Vitreoretinopathy	BEFREE	15981244, 21151595, 21177847		★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	27188753	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	16601243	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary macular coloboma	Coloboma of macula	ORPHANET_DG	26908622		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	31082802	Associate	★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	22576020		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	29160422		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	29160422		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	37595345	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	15557753		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25428027	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30556883	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29482174, 30556883		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29458020		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25209439, 27323393, 27859262, 28215225		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28895566, 29930766, 30051493		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30622113, 31431458		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17545618, 19956716, 22182510, 22606268, 25313882, 27815069		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25274627		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	21937024		★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	28111184		★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	Pubtator	36695497	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	24755605		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	33633439	Associate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	31726413		★☆☆☆☆ Found in Text Mining only
NAIL DISORDER, NONSYNDROMIC CONGENITAL, 9	Nail Diseases	BEFREE	22211385		★☆☆☆☆ Found in Text Mining only
Nail dysplasia	Nail dysplasia	BEFREE	22211385		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	31082802	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27373314		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	21472018		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19421142		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15705594		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31534019		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10688908	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15087387, 17318900		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	17318900	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33723319	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33618667	Associate	★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	22576020		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	27818488	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28895566, 29930766, 30051493		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34697900	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	19399181, 26202350, 29441905		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	27188753	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25861751		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	21151595		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31735061		★☆☆☆☆ Found in Text Mining only
Smith-Lemli-Opitz Syndrome	Smith-Lemli-Opitz Syndrome	BEFREE	26998835		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19543744	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30622113, 31431458		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17273778		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30624523, 33618713, 35848483	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	11315916		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	11315916	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21898546, 27859262		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17939044		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34562599	Associate	★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams Syndrome	BEFREE	9147651		★☆☆☆☆ Found in Text Mining only