CXCR4 (C-X-C motif chemokine receptor 4)

Gene

• Entrez ID: 7852
• Gene name: C-X-C motif chemokine receptor 4
• Gene symbol: CXCR4
• Synonyms (NCBI Gene): CD184, D2S201E, FB22, HM89, HSY3RR, LAP-3, LAP3, LCR1, LESTR, NPY3R, NPYR, NPYRL, NPYY3R, WHIM, WHIMS, WHIMS1
• Chromosome: 2
• Chromosome location: 2q22.1
• Summary: This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000006	hsa-miR-146a-5p	qRT-PCR, Luciferase reporter assay, Western blot	18568019
MIRT000006	hsa-miR-146a-5p	qRT-PCR, Luciferase reporter assay, Western blot	18568019
MIRT000006	hsa-miR-146a-5p	qRT-PCR, Luciferase reporter assay, Western blot	18568019
MIRT000006	hsa-miR-146a-5p	Luciferase reporter assay, qRT-PCR, Western blot	18568019
MIRT000006	hsa-miR-146a-5p	Luciferase reporter assay, qRT-PCR, Western blot	18568019
MIRT000006	hsa-miR-146a-5p	Luciferase reporter assay, qRT-PCR, Western blot	18568019
MIRT000635	hsa-miR-224-5p	Luciferase reporter assay, qRT-PCR, Western blot	20023705
MIRT006668	hsa-miR-150-5p	FACS, Western blot	22039399
MIRT000006	hsa-miR-146a-5p	Microarray	20375304
MIRT030235	hsa-miR-26b-5p	Microarray	19088304
MIRT054160	hsa-miR-139-5p	ChIP-seq, Flow, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	21925125
MIRT054160	hsa-miR-139-5p	ChIP-seq, Flow, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	21925125
MIRT054425	hsa-miR-126-3p	qRT-PCR, Western blot	24532280
MIRT054715	hsa-miR-9-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	24318902
MIRT054425	hsa-miR-126-3p	Luciferase reporter assay, Western blot	23744532
MIRT054425	hsa-miR-126-3p	Luciferase reporter assay, Western blot	23744532
MIRT054425	hsa-miR-126-3p	Luciferase reporter assay, Western blot	23744532
MIRT054425	hsa-miR-126-3p	Luciferase reporter assay, Western blot	23744532
MIRT054715	hsa-miR-9-5p	Luciferase reporter assay, Western blot	24141785
MIRT054715	hsa-miR-9-5p	Luciferase reporter assay, Western blot	24141785
MIRT438701	hsa-miR-494-3p	Immunocytochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24644030
MIRT438214	hsa-miR-133b	Luciferase reporter assay, qRT-PCR, Western blot	24330809
MIRT438214	hsa-miR-133b	Luciferase reporter assay, qRT-PCR, Western blot	24330809
MIRT054715	hsa-miR-9-5p	Luciferase reporter assay	24170200
MIRT054715	hsa-miR-9-5p	Luciferase reporter assay	24170200
MIRT054425	hsa-miR-126-3p	Luciferase reporter assay	24189753
MIRT054425	hsa-miR-126-3p	Luciferase reporter assay	24189753
MIRT054715	hsa-miR-9-5p	Luciferase reporter assay, Western blot	24141785
MIRT054715	hsa-miR-9-5p	Luciferase reporter assay, Western blot	24141785
MIRT438701	hsa-miR-494-3p	Immunocytochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24644030
MIRT438214	hsa-miR-133b	Luciferase reporter assay, qRT-PCR, Western blot	24330809
MIRT438214	hsa-miR-133b	Luciferase reporter assay, qRT-PCR, Western blot	24330809
MIRT054715	hsa-miR-9-5p	Luciferase reporter assay	24170200
MIRT054715	hsa-miR-9-5p	Luciferase reporter assay	24170200
MIRT054425	hsa-miR-126-3p	Luciferase reporter assay	24189753
MIRT054425	hsa-miR-126-3p	Luciferase reporter assay	24189753
MIRT731652	hsa-miR-622	ChIP-seq, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26404566
MIRT731652	hsa-miR-622	ChIP-seq, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26404566
MIRT731652	hsa-miR-622	Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	26404566
MIRT731652	hsa-miR-622	Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	26404566
MIRT000006	hsa-miR-146a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26082201
MIRT731652	hsa-miR-622	Luciferase reporter assay, qRT-PCR, Western blot	26082201
MIRT733087	hsa-miR-381-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), qRT-PCR, In situ hybridization	31815619
MIRT733087	hsa-miR-381-3p	Luciferase reporter assay, qRT-PCR, Western blotting	32016478
MIRT054715	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blotting	32635336
MIRT734511	hsa-miR-330-5p	Western blotting	32665904
MIRT734526	hsa-miR-143-3p	qRT-PCR	32449873
MIRT734935	hsa-miR-148a-3p	RNA-seq, Flow cytometry, ELISA	33336366
MIRT736049	hsa-miR-140-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32101839
MIRT054160	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	34070538
MIRT737210	hsa-miR-127-5p	Western blotting, RNA-seq, Immunofluorescence, ELISA	31719921
MIRT737311	hsa-miR-204-3p	Luciferase reporter assay, qRT-PCR	32521912
MIRT000006	hsa-miR-146a-5p	Western blotting, qRT-PCR	37095967
MIRT756120	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR, RNA-seq, ChIP-seq, Flow cytometry	36597126
MIRT000006	hsa-miR-146a-5p	qRT-PCR	36415628
MIRT918223	hsa-miR-1910	CLIP-seq
MIRT918224	hsa-miR-204	CLIP-seq
MIRT918225	hsa-miR-211	CLIP-seq
MIRT918226	hsa-miR-3120-3p	CLIP-seq
MIRT918227	hsa-miR-3148	CLIP-seq
MIRT918228	hsa-miR-3187-3p	CLIP-seq
MIRT918229	hsa-miR-3653	CLIP-seq
MIRT918230	hsa-miR-3658	CLIP-seq
MIRT918231	hsa-miR-4435	CLIP-seq
MIRT918232	hsa-miR-4511	CLIP-seq
MIRT918233	hsa-miR-4681	CLIP-seq
MIRT918234	hsa-miR-4701-5p	CLIP-seq
MIRT918235	hsa-miR-4755-5p	CLIP-seq
MIRT918236	hsa-miR-4773	CLIP-seq
MIRT918237	hsa-miR-548b-3p	CLIP-seq
MIRT918238	hsa-miR-548s	CLIP-seq
MIRT918239	hsa-miR-588	CLIP-seq
MIRT918240	hsa-miR-623	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Unknown	11874984
CREB3	Activation	20473547
DNMT1	Repression	19932585
ERG	Activation	19396168;23918819
ETS1	Unknown	21741415
FOXO1	Activation	20068066
HDAC3	Repression	20473547
HIF1A	Activation	17075581
HIF1A	Unknown	19212630
IRF2	Repression	21447649
KLF2	Repression	19671192
KLF5	Activation	19460858
MYC	Activation	10229837
NFKB1	Activation	12690099;20068066
NFKB1	Unknown	20157762
NRF1	Activation	10381170;20068066
PAX3	Activation	20068066
RELA	Activation	12690099;16267013;20068066
RELA	Unknown	20157762
SNAI2	Activation	22074556
USF1	Activation	10229837
USF2	Activation	10229837
VHL	Repression	13679920
YBX1	Activation	17072343
YY1	Repression	10229837;11145693;12571248;15737629;15805285;20068066
YY1	Unknown	14563373
ZBTB16	Activation	18568019

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0001618	Function	Virus receptor activity	TAS	10228019
GO:0001666	Process	Response to hypoxia	IEP	15174142
GO:0002407	Process	Dendritic cell chemotaxis	TAS	16621978
GO:0003779	Function	Actin binding	IDA	12421915
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	8276799
GO:0004950	Function	Chemokine receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	10644702, 12421915, 15660419, 17077324, 18632580, 18765807, 19106094, 19380869, 19665027, 20215400, 20802527, 21730065, 23170857, 23773523, 23926103, 24094005, 25775528, 27331810, 28862946, 28978524, 29386406, 34927784
GO:0005737	Component	Cytoplasm	TAS	10415069
GO:0005764	Component	Lysosome	IDA	24790097
GO:0005764	Component	Lysosome	IDA	21540189
GO:0005764	Component	Lysosome	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	24790097
GO:0005769	Component	Early endosome	IDA	21540189
GO:0005769	Component	Early endosome	IEA
GO:0005770	Component	Late endosome	IDA	21540189
GO:0005770	Component	Late endosome	IEA
GO:0005886	Component	Plasma membrane	IDA	19665027, 21540189
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10393923
GO:0006915	Process	Apoptotic process	TAS	10942389
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	TAS	8276799
GO:0006955	Process	Immune response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	10644702
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	34239069
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	39093700
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	ISS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007420	Process	Brain development	IBA
GO:0009615	Process	Response to virus	TAS	10583963
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	10521508, 10644702, 18308860, 19106094, 19665027, 23620790
GO:0015026	Function	Coreceptor activity	TAS	10754293
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA
GO:0016494	Function	C-X-C chemokine receptor activity	IDA	8752281
GO:0016494	Function	C-X-C chemokine receptor activity	NAS	9468539
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019722	Process	Calcium-mediated signaling	IMP	19064997
GO:0019955	Function	Cytokine binding	IEA
GO:0019957	Function	C-C chemokine binding	IBA
GO:0019957	Function	C-C chemokine binding	IPI	25612609
GO:0022008	Process	Neurogenesis	IBA
GO:0030155	Process	Regulation of cell adhesion	IDA	19703720
GO:0030334	Process	Regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	20023705
GO:0031252	Component	Cell leading edge	IDA	12421915
GO:0031410	Component	Cytoplasmic vesicle	IDA	10521508, 19106094
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	19116316
GO:0032027	Function	Myosin light chain binding	IDA	12421915
GO:0032991	Component	Protein-containing complex	IDA	19665027
GO:0032991	Component	Protein-containing complex	IMP	25612609
GO:0038147	Function	C-X-C motif chemokine 12 receptor activity	IDA	28978524, 39093700
GO:0038160	Process	CXCL12-activated CXCR4 signaling pathway	IDA	28978524, 39093700
GO:0038160	Process	CXCL12-activated CXCR4 signaling pathway	IGI	27693460
GO:0038160	Process	CXCL12-activated CXCR4 signaling pathway	IMP	24912431
GO:0043130	Function	Ubiquitin binding	IDA	20228059
GO:0043217	Process	Myelin maintenance	ISS
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	ISS
GO:0060326	Process	Cell chemotaxis	IBA
GO:0060326	Process	Cell chemotaxis	IDA	19106094
GO:0060326	Process	Cell chemotaxis	IMP	19106094
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0071345	Process	Cellular response to cytokine stimulus	IDA	21540189
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	25016030
GO:1904018	Process	Positive regulation of vasculature development	IMP	27693460
GO:2000448	Process	Positive regulation of macrophage migration inhibitory factor signaling pathway	IMP	19665027

Other IDs

• MIM: 162643
• HGNC: 2561
• e!Ensembl: ENSG00000121966

Protein

• UniProt ID: P61073
• Protein name: C-X-C chemokine receptor type 4 (CXC-R4) (CXCR-4) (FB22) (Fusin) (HM89) (LCR1) (Leukocyte-derived seven transmembrane domain receptor) (LESTR) (Lipopolysaccharide-associated protein 3) (LAP-3) (LPS-associated protein 3) (NPYRL) (Stromal cell-derived facto
• Protein function: Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation (PubMed:10452968, PubMed:18799424, PubMed:24912431, PubMed:28978524). Involved in the AKT
• PDB: 2K03, 2K04, 2K05, 2N55, 3ODU, 3OE0, 3OE6, 3OE8, 3OE9, 4RWS, 8GP3, 8I0Q, 8K3Z, 8U4N, 8U4O, 8U4P, 8U4Q, 8U4R, 8U4S, 8U4T, 8YU7, 8ZPL, 8ZPM, 8ZPN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12109	CXCR4_N	6 → 38	CXCR4 Chemokine receptor N terminal	Domain
  PF00001	7tm_1	55 → 302	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in numerous tissues, such as peripheral blood leukocytes, spleen, thymus, spinal cord, heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, cerebellum, cerebral cortex and medulla (in microglia as well as in astro
• Sequence:

  MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI
  LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL
  YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA
  DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
  TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
  LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS

• Sequence length: 352

Pathways

KEGG:

Viral life cycle - HIV-1
Virion - Human immunodeficiency virus
Calcium signaling pathway
Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
Endocytosis
Axon guidance
Leukocyte transendothelial migration
Intestinal immune network for IgA production
Regulation of actin cytoskeleton
Human cytomegalovirus infection
Human immunodeficiency virus 1 infection
Pathways in cancer

Reactome:

Binding and entry of HIV virion
Signaling by ROBO receptors
Chemokine receptors bind chemokines
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Inherited Immunodeficiency Diseases	Likely pathogenic; Pathogenic	rs1573613529	RCV001027567	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neoplasm	Pathogenic	rs1684842255	RCV006274177	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Warts, hypogammaglobulinemia, infections, and myelokathexis	Pathogenic; Likely pathogenic	rs1684840786, rs2104915680, rs2104915518, rs2104915668, rs2104915548, rs2104915575, rs2104915487, rs104893624, rs730880320, rs104893626, rs1240625960, rs1684841455, rs1684842255	RCV001339385 RCV001378387 RCV001987089 RCV001917510 RCV001927193 RCV001994757 RCV002018479 RCV000015063 RCV000015065 RCV000015067 RCV000696270 RCV001035858 RCV005094288	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
WHIM syndrome 1	Pathogenic; Likely pathogenic	rs1684840786, rs2104915543, rs104893626, rs104893624, rs730880320, rs104893625, rs1573613529	RCV001801249 RCV005420416 RCV002249021 RCV001801237 RCV001801238 RCV001801239 RCV001801240 RCV002481839	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, JUVENILE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CXCR4-related disorder	Likely benign; Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELOPROLIFERATIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WHIM SYNDROME	—	CTD, ClinGen, Disgenet, GWAS catalog, GenCC, Orphanet CTD, ClinGen, Disgenet, GWAS catalog, GenCC, Orphanet CTD, ClinGen, Disgenet, GWAS catalog, GenCC, Orphanet CTD, ClinGen, Disgenet, GWAS catalog, GenCC, Orphanet CTD, ClinGen, Disgenet, GWAS catalog, GenCC, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
22q11 Deletion Syndrome	22q11 deletion syndrome	BEFREE	24101523		★☆☆☆☆ Found in Text Mining only
Achondroplasia	Achondroplasia	Pubtator	28729430	Associate	★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	29515781, 31245296, 31620068		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	15781337		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	12472574, 29777009, 30365110		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10803521, 12472574, 16236608, 16679918, 23294096, 23754844, 25072364, 27686375, 30453100, 31346528, 31809874		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	18955566, 20035824, 25294819, 27135782, 28280274, 30127892, 30204524, 30228947		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	31518054		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28755135		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	19291801, 30335884		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	31260716		★☆☆☆☆ Found in Text Mining only
Adamantinous Craniopharyngioma	Adamantinous Craniopharyngioma	BEFREE	24934367		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15328206, 15662133, 17176471, 26678890, 30076481		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17176471, 17504381		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	29208671		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28318328, 28721072, 30103827		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	15548713, 19352387, 20462600, 31451931		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	25712054, 29137361		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	19020745, 22847686, 23835861, 25118295, 28772134		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	LHGDN	19020745		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	20309720		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	20865359		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	22210714		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	29279316		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	27986950		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	29088715, 30349656		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	33281749	Associate	★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10803521, 16236608, 16679918, 23754844, 25072364, 31346528		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	27135782		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	22936065, 25231113, 25704881, 28952842, 29777009, 29954928, 30774774, 31248974		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	19927352		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	18924150, 23497290, 24632620, 25400097, 28031228, 29771176		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	19657116		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	29366593		★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	Pubtator	15026312, 17270027, 18556651, 20148920, 20226738, 33415666, 33485325, 35588454	Associate	★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	BEFREE	15604887		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	22789920		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	19020745, 22847686, 23835861, 25118295, 29088715		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	12444153		★☆☆☆☆ Found in Text Mining only
Alveolar capillary dysplasia	Alveolar capillary dysplasia	Pubtator	35649494	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17188679, 23824053, 36569892	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30080220, 37801139	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	22853858		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	31780812	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	27270413		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	29592817	Stimulate	★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	18089812		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	22797698, 28831064	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Refractory	Refractory anemia	Pubtator	19692701	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	32868775	Associate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	12093767		★☆☆☆☆ Found in Text Mining only
Anhydrotic Ectodermal Dysplasias	Hypohidrotic ectodermal dysplasia	BEFREE	15604887		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	30816502		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26976451, 27986950, 28581520, 30902754, 31432181		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	36519232	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	26346005	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	36519232	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	24876351, 26346005		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	19020745, 22847686, 23835861, 25118295, 29088715		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	25647836, 28831064		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10411001, 16343467, 19527467, 24816217, 28450349, 29304539, 29581828, 30520941, 31004184, 31289820, 31549940, 31653710		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12096225, 12509607, 17550983		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	15681827		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	27005825, 28619088, 29880013	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	27005825	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	32733468	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10323455, 11817585, 15382150, 16507142, 17082220, 19538721, 19804625, 20738854, 22275188, 27385284, 27411480, 31729947, 32111105, 32264938, 33042152, 34484236	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24433281	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	31081041, 35095831	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	15788997, 25441632, 29680839		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	15788997, 19223978, 36197221	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	16357147, 17391642, 18512766, 19336886, 24970694, 8995603		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	19336886, 22086906, 24970694	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	30819232	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	32166899	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10411001, 16343467, 19527467, 24816217, 28450349, 29304539, 29581828, 30520941, 31004184, 31289820, 31549940, 31653710		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24423463, 28775206, 28932900, 29967943, 30520941, 31004184, 31653710, 32787365, 35055054, 36094626, 36519232	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	19761697, 30760287, 32383373, 32682418, 33755965, 35919038, 36042613	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	35607269	Stimulate	★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	15026622		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11966764, 14612668, 26216880, 27005825, 30827936, 31747563		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	22367177, 23764537, 27005825, 30018141, 30827936, 35908411, 37388364	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	31714901	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	22936065, 24711662, 28952842, 31018830		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	15155773, 16840734, 30416684		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	29208671		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	25733313	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	30867081		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	15540205, 15582259, 21315786, 22982413, 23526079, 26782415, 29022185, 29526013		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	15540205		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	15805265		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	10666407	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet-type bleeding disorder	BEFREE	20708218		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	19237480, 21741415, 28143986, 39503766	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	23456977		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	22936065, 24553177, 24651452, 27301862, 31554271, 34289017, 36210485	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	27301862, 28294689		★☆☆☆☆ Found in Text Mining only
Bone Marrow Neoplasms	Bone Marrow Neoplasms	BEFREE	16627256		★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	18337451		★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	18337451	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	12485835, 24934367, 25227814, 26299663, 27863376, 28350074, 29696364, 29941486, 9881942		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	12485835		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	19625779, 24934367, 25227814, 26000059, 26689941, 29696364, 29849822, 32410920	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	19739271, 22430135, 28952213	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12370187, 12626353, 12935890, 12941798, 15029227, 15180966, 15472715, 15516962, 15805285, 15809737, 16061624, 16112111, 16172123, 16239110, 16390867, 16457694, 16836568, 17131341, 17351259, 17517823, 17574038, 17724466, 17959712, 18270814, 18316615, 18570923, 18670789, 19125297, 19196101, 19212630, 19226458, 19438749, 19497995, 19500800, 19584257, 19816083, 19830694, 19927352, 20043076, 20594270, 20603605, 20798912, 21383699, 21448932, 21573501, 21617219, 21831961, 21906588, 22152016, 22220212, 22264762, 22266857, 22432781, 22699677, 22767589, 22884683, 22941282, 23023398, 23053995, 23647548, 23827153, 23966000, 24045366, 24101191, 24200972, 24256053, 24403602, 24448360, 24591761, 24782546, 24870556, 24906407, 24909174, 25030358, 25310198, 25321183, 25358600, 25376609, 25544759, 25753200, 25773070, 25955111, 25956853, 25978539, 26062751, 26095299, 26287601, 26356032, 26397146, 26452556, 26495998, 26576337, 26722521, 26923331, 27049755, 27157541, 27185877, 27214240, 27461876, 27556298, 27820834, 28012397, 28035725, 28356948, 28446538, 28534508, 28694161, 28703799, 28844962, 28929029, 28952213, 29131020, 29263923, 29339479, 29391899, 29435066, 29658570, 29682200, 29708077, 29985577, 30012106, 30015868, 30191351, 30209686, 30236259, 30251699, 30259651, 30274780, 30441765, 30486409, 30564115, 30632021, 30822630, 31010839, 31106142, 31111958, 31190884, 31388305, 31698158, 31702806, 31705019, 31737891		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	25753200		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast Diseases	BEFREE	24206539		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	28454081	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12370187, 12433920, 12927045, 13679920, 15033669, 15542424, 15739262, 16457694, 16627550, 16740704, 16863915, 17351259, 17699109, 18083706, 18670789, 18807177, 19025611, 19237480, 19497995, 19567784, 19939894, 20126581, 20154716, 20181250, 20798912, 20926736, 21048319, 21087507, 21167057, 21318602, 21448932, 21454012, 21695171, 21831961, 22220212, 22767589, 22791584, 22853317, 22884683, 22941282, 23046610, 23543442, 23591873, 23868972, 24101191, 24200972, 24375039, 24467226, 24583601, 24692066, 24770893, 24810923, 24906407, 25321183, 25376609, 25753200, 25912576, 26231656, 26251419, 26413813, 26576337, 26722521, 26896000, 27185877, 27556298, 28446538, 28454081, 28703799, 28952213, 29050986, 29131020, 29353288, 29516917, 29658570, 29747452, 29849822, 29906404, 30015868, 30251699, 30786682, 30829272, 31370904, 31702806, 31991851, 32075106, 32188473, 32836215, 33531802, 34920184, 35045088, 35481418, 35672854, 35985446, 36077241, 36233192, 36617771, 40362664	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	23827153, 32702599	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	32188473	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	19059110		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	21233340		★☆☆☆☆ Found in Text Mining only
Burkitt Leukemia	Burkitt`s Lymphoma	BEFREE	27071778		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	21672222	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	9881942		★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	28454388		★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	24970800	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21076047, 23468933, 25114911, 25400739, 26404566, 26576337, 26823797, 29745083, 31011147, 31534521, 35083551, 36564369	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15026622, 15837745, 17893878, 20386750, 23856249, 24629239, 29682200, 30012106		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	22916293, 35799158	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	21521526, 23009155, 24398989, 25301050	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	26744317	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12149145, 12651617, 16819541, 17075975, 17259344, 18954561, 19508713, 21110890, 21909361, 24614035, 25363530, 26404566, 28102846, 28584306, 29391759, 31415486, 31534521, 31746344, 32483419, 33122398, 34555268, 35941537	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	23495012, 26415052	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	19583841	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	22814318	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15540205, 15582259, 22982413, 23526079, 26782415, 29022185, 29526013		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	26261502, 28475003		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16322285, 17113184, 17916907, 20147779, 21292343, 25775124, 26141860, 26338423, 26494555, 27035564, 27845045, 28076327, 28851689, 28925100, 29171984, 29344197, 29745083, 30257500, 30355915, 31287095		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	17926037, 20460402, 21527066, 24209634, 33676525, 34916377, 35545781	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	23650783, 25679210, 35797269, 36112544, 36142575, 37697316, 38471128, 40019403, 40269781	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	13679920, 22471472, 23039915, 24327013, 24714746, 27279483, 28923105, 31850854, 32775427, 34266404, 34449964, 35259193, 36982302, 37010151	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27638770	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33827033	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18310089, 18505078, 35358193, 36308553	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	16634895, 17099730, 30534824		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	28277316, 29146630		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15921680, 16288025, 17173958, 17893878, 20460402, 21115652, 22241961, 23372646, 24209634, 24762228, 25149650, 25320277, 26235278, 28753202, 29146630, 30191987, 30822630		★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	18453750, 19688824, 21482691		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	31071921		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	30837882		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	19438749		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	12697743, 14990582, 18286257, 28775206, 29967943, 30520941	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29967943, 29996650, 30678240, 31289820, 31549940		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	34140767	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	30002148		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	31004184, 32037372, 33319833	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	11817585, 18205922, 27356492, 33773470	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar diseases	Pubtator	30819232	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	30863202		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	18596986, 19246697, 27006446, 27938478, 28547726, 29776406		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23856487, 25114911, 27697997, 29417588		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21887463, 23856487, 24728301, 25114911, 27697997, 29417588		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	29160519	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10803521, 16236608, 16679918, 23754844, 25072364, 30005184, 31346528		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	23754844, 27135782		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	18924150, 23497290, 24632620, 25400097, 28031228, 29771176		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	16565491, 17461449, 22664794, 27809873, 29282035	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	17461449, 22727731, 26855082, 29282035, 31059778		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	17461449		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	17328838, 28383652	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	18814143, 20102637, 23686836		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	20102637, 21631268, 26013170	Associate	★☆☆☆☆ Found in Text Mining only
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Choreoathetosis	Pubtator	35045088	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	11200816		★☆☆☆☆ Found in Text Mining only
Christ-Siemens-Touraine syndrome	Hypohidrotic Ectodermal Dysplasia, X-Linked	BEFREE	15604887		★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	22673496		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	24637920, 27960539		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	12783211		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15155773, 16840734, 19812382, 21093051, 21936770, 24659821, 24914134, 25294819, 25895128, 26282174, 26659815, 26825709, 27127886, 27173875, 27840426, 28526063, 29642081, 29705266, 29955944, 30333224, 30416684, 30787933, 31292126, 31352850		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	19006565		★☆☆☆☆ Found in Text Mining only
Chronic neutropenia	Neutropenia	BEFREE	16154852		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	30863202		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	20109310		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	26203228, 30569507		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	23982215		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	19287188	Associate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	30005184		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	24687413, 29218082, 30112037, 30678736		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	21087446	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12839981, 19305148, 20460542, 20798912, 22871210, 24629239, 25232565, 25899003, 25960214, 26552750, 26678887, 27517626, 28739729, 29235568, 29907957, 31500630, 31825725		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	20865359	Stimulate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	31073530	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	31815761		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15837989, 16125170, 16794396, 17143542, 17707368, 18416455, 18959627, 19588204, 20177796, 21349176, 22689289, 22871210, 23098564, 24085800, 24238971, 24330809, 24532280, 24559209, 24629239, 24647809, 25150783, 25580640, 25866254, 25899003, 26406413, 26552750, 26745593, 26985708, 27835894, 28176874, 28554753, 28621237, 28928094, 28936810, 29063978, 29436696, 29719205, 29887884, 30092218, 30190334, 30337690, 30355650, 30506718, 30678736, 30851425, 31244335, 31524146, 31818187, 31825725		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15592929, 16641550, 16794396, 18416455, 18443596, 18959627, 19568410, 20798912, 20865359, 20953377, 21349176, 21350711, 23071744, 23098564, 24330809, 24395653, 24559209, 24629239, 25735334, 25899003, 26078947, 26678887, 26985708, 27160279, 27503580, 27798120, 28629469, 28739729, 29235568, 30355650, 31500630, 31524146, 32373955, 33966046, 34930323, 35506454, 36591565, 36882818, 37530325	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16675573, 17641542, 18416455, 18443596		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	17707368, 22871210		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	33859323	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	30819232	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	27840426		★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	BEFREE	28559980		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	22727731, 30214622		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	19628780, 29106576		★☆☆☆☆ Found in Text Mining only
Congenital neutropenia	Congenital Neutropenia	GENOMICS_ENGLAND_DG	12692554, 15536153		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	22673496, 30837882, 31071921		★☆☆☆☆ Found in Text Mining only
Conn Adenoma	Conn Adenoma	BEFREE	29279316		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	13679920, 15210854, 16024619, 17083723, 18189328, 19796655, 20578990, 21127401, 22972438, 24012533, 24032722, 26439684, 27634189, 27638770, 28279221, 28846693, 29088715, 29218250, 30985424, 31494331		★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal neovascularization	Pubtator	26727921	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	29801148		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28961998, 29581828, 30342381, 31549940		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	25660395, 29967943, 31886261, 34552562	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28431006, 29581828, 30342381		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	32016478	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29581828, 30342381		★☆☆☆☆ Found in Text Mining only
Corticobasal Degeneration	Corticobasal degeneration	Pubtator	28271184	Associate	★☆☆☆☆ Found in Text Mining only
CRANIOOSTEOARTHROPATHY	Cranioosteoarthropathy	BEFREE	25441632		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	24934367		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	24934367	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	22238186, 24687413		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	25892890	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	15756007, 25211166, 27167239		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11352237, 11817585, 15965952, 24516346, 27356492, 28131784, 29414810, 30005876, 30942441, 31108241		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	11115360, 32303038	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	16944452		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	10190687, 29283028		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	15788997, 36142206	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	15788997, 27956056		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	29366593		★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	37348915	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	25495026, 25549045, 28783870, 29119710, 31001066		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	18286257	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18286257, 30184318, 30321232	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	25495026, 25549045, 28783870, 29091208, 29119710, 31001066		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	34267242	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18286257, 18461161	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17390024, 18210030, 18461161		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	39991734	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	29207157, 38206700, 39512693	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	25549045, 28332276		★☆☆☆☆ Found in Text Mining only
Diabetic Neuralgia	Diabetic Neuralgia	BEFREE	29533926		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29862173, 30870116		★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	24992171		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	16373702, 22722314, 22936065, 25231113, 25704881, 28952842, 29777009, 29920526, 29954928, 30373149, 30774774, 30904045, 31248974, 31471373, 31554271		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	29673232	Stimulate	★☆☆☆☆ Found in Text Mining only
Dyskinesia Familial with Facial Myokymia	Dyskinesia, familial, with facial myokymia	Pubtator	30636773	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	15788997, 27956056, 31287410		★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	LHGDN	15184910		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	26678890, 28402926		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	21607621, 23985752, 26678890, 28402926, 28469794, 29383153		★☆☆☆☆ Found in Text Mining only
Endometrial Diseases	Endometrial Diseases	BEFREE	30106199		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22025313, 24416254, 26678890	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	26678890		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	17506907, 20720261, 24534089, 27323121, 27729562, 29050963, 29161347, 29450941, 30106199		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	20720261, 27323121, 27729562, 29161347	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Partial with Variable Foci	Progressive myoclonic epilepsy	Pubtator	19325708	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28104461		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	16288025, 24209634, 25320277, 28753202		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	21617219		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17176471, 23192861, 23744460, 23800042, 26130416, 28193907, 28405006, 28467773, 29208671		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	17171785, 17176471, 24074251, 27041792, 28467773, 33579381	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17176471, 26130416, 28193907, 28405006, 28467773, 29208671		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	12901795, 17176471, 19550128, 23497377, 26092504	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	15183454, 20525755, 23075330, 24282276, 24651452, 26321665, 26428435, 27528222, 28549419, 29776413, 31810195		★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	34289017	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	18279715		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	18279715		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	24054763	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	24997224	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	24997224		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29463989, 29518606		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	24637920		★☆☆☆☆ Found in Text Mining only
Focal Segmental Glomerulosclerosis, Not Otherwise Specified	Focal segmental glomerulosclerosis	BEFREE	24637920		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	22553346		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	21986127, 32512633	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	25400739		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	22936065	Associate	★☆☆☆☆ Found in Text Mining only
Gastro-enteropancreatic neuroendocrine tumor	Digestive system neuroendocrine neoplasm	BEFREE	28529632		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	19568410, 34484469, 34609417	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	24120239		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	26936919		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	39464891	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	GATA2 Deficiency	BEFREE	26710799		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	25564295		★☆☆☆☆ Found in Text Mining only
Genetic Predisposition to Disease	Genetic predisposition to disease	Pubtator	15536153	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	30900102		★☆☆☆☆ Found in Text Mining only
Gingival Diseases	Gingival diseases	Pubtator	33934404	Associate	★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	37986309	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	26275042	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	26275042	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	12761880, 17075581, 18083706, 18812968, 19008040, 19923906, 22427929, 24023874, 25860928, 26909116, 28040478, 28423060, 30467961, 32632898, 33550492, 33596115, 35464424, 39300240	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15921680, 17108064, 17391642, 17415525, 18512766, 18812968, 19212671, 19646959, 19923906, 21084856, 21294158, 23714687, 24023874, 24335554, 25326893, 25367885, 25676691, 25860928, 25962108, 26299663, 26608373, 26821357, 27542769, 27863376, 28040478, 28639900, 28734730, 28938636, 29158842, 29297738, 29767255, 30451884, 30867843, 31025274, 31098995, 31537527, 31812931, 9881942		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	19008040		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21084856, 26608373, 37757768, 39690071	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15921680, 17391642, 17415525, 18812968, 19646959, 19923906, 22427929, 24023874, 25326893, 25367885, 25676691, 25860928, 25962108, 26299663, 26608373, 27542769, 27863376, 28040478, 28423060, 28639900, 28685624, 28734730, 28938636, 29158842, 29297738, 29507625, 29767255, 30127875, 30451884, 30867843, 31025274, 31098995, 31382985, 31537527, 31812931, 9881942		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	12388552, 16084492, 17881971, 19008040		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	12388552, 16760646, 17066899, 17075581, 17404502, 18812968, 19008040, 19336886, 19923906, 20157762, 21084856, 23865743, 24050252, 24150861, 24249397, 24970694, 25227814, 26000059, 26782381, 28423060, 32035133, 32111758, 33069830, 39690071	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15967572, 17786309, 17849315, 17881971, 18812968, 19074827, 19336886, 19923906, 20157762, 20929586, 21084856, 21109930, 21294158, 21618540, 22922481, 23494875, 24150861, 24249397, 26277915, 26782381, 27594591, 27863376, 28350074, 28423060, 29941486, 31025274, 31072428		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22086906	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	21106847		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	27960539		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	22789920		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	33507926	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	20025985, 24621606, 34539656	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	28615072	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	12414528	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	11443213, 21956421		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	19897675, 24684463, 27471912	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	27471912	Associate	★☆☆☆☆ Found in Text Mining only
Growth Hormone-Secreting Pituitary Adenoma	Somatotroph Adenoma	BEFREE	19473177		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	10190687		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	21380786, 26374452, 29061496, 29749473		★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	30819232	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29784000		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	30819232	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30837882, 31071921		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	38065888, 38169915	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure, Right-Sided	Heart Failure	BEFREE	28209402		★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	16024619, 17070589, 17218907, 24138046, 26920352, 27388534		★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	LHGDN	17070589		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	40474296	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	24500843	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	21443538, 34049979	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	22186993, 25083818, 26942591, 28526063, 29212254, 29296751, 29903571, 30342023, 30939009, 31260155		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	18042197, 30254339, 31475113		★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	22232208, 22660553		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	25853747	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	15048728	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	15048728, 20710056	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	12761880, 25753200, 32393308	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	23769877		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	11830455, 18488221	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	19927352		★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	29279316, 39659571	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	26010611	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28332276, 31018749		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	31018749, 34639171	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27475229, 30904607		★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	18957686, 22536419		★☆☆☆☆ Found in Text Mining only
Hypogammaglobulinemia	Hypogammaglobulinemia	BEFREE	23009155		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	15802268, 16929169, 17075581, 17442415, 17594938, 20068066, 20102637, 20151982, 21521526, 22767589, 24618817, 24629239, 24651452, 26013170, 26045293, 27356492, 28526501, 30760238, 30781795, 32033172, 35634326	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20157762, 35942521, 35985446, 36214722, 39328420	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	15019705, 30508148		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	19628780, 29805477, 31023308		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	20067420, 20483575, 25103869, 28979687, 29453386, 29499695, 29507348, 30567353, 31644934		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	20483575, 20646340	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	21309737, 29507348, 32822674, 32843095	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	15598422, 23053995, 27363619, 29232699		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	18519809, 20708218, 31053569		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10786999, 11023494, 11884536, 12186908, 12368305, 15454484, 15598422, 15781337, 20460542, 20472031, 20683317, 21070597, 21178277, 21284900, 23817178, 24111611, 29427452, 30020413, 30520941, 31652152		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	15019705		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11141322, 11393656, 19774645, 21440527, 24687413, 30112037, 30285606		★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	17351259		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	27220474, 31173219, 32901877	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	15867478		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	24373354	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	15867478, 20032431	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	25471741		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	19438749		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	24687413, 31377592		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29896417, 30125595		★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	31451931		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504, 26387944		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	27005825		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	25102944		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504, 26387944		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504, 26387944		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	14501286, 15110993, 17353903, 20023696		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	30489627		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	27960539, 29114002		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	34826532	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	15033669, 29868028	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	23794207		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	LHGDN	11953881		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	11953881, 23192271, 24511119, 27638770, 36551144	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	35226449	Stimulate	★☆☆☆☆ Found in Text Mining only
Large cell carcinoma of lung	Lung Carcinoma	BEFREE	22653095		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	26261502	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	16196460		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	22002092	Inhibit	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10452968, 18955566, 18957686, 20594270, 21448932, 21984373, 23754844, 24497931, 25070183, 26058075, 26058076, 26398122, 26931577, 27154815, 27175029, 27775528, 28779088, 29481882, 29603337, 30178381, 31185279, 31292126, 31518054, 31669202, 9881942		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11023495, 11399509, 16888090, 18957686, 19789386, 20145264, 22613469, 23754844, 24500843, 26045293, 26806619, 27127886, 30208330, 31260716, 31518054, 32697348, 34619434, 39744224, 9616148	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	12208881, 18957686		★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	37137530	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	17005036	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	12829025, 16888090, 17315232, 18957686, 20810927, 21456010, 23754844, 23798675, 24035716, 24500843, 25193961, 26045293, 26246143, 27258612, 27577048, 30208330, 31112940, 31169718, 31171000, 31434952, 31518054, 32456622, 32580317, 32697348, 33382018, 33906294, 34244611, 36473282, 36718632, 39744224, 9616148	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24615181	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	19291801	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	17715399, 18769446, 18955566, 18957686, 20035824, 20810927, 21607655, 22669506, 23676502, 23754844, 23798675, 23817178, 24500843, 24659821, 24851270, 25294819, 25312253, 25835070, 26082201, 26246143, 26742943, 27135782, 27154815, 27175029, 27577048, 28280274, 28779088, 29140182, 29574276, 29724902, 29914885, 30127892, 30204524, 30228947, 30422351, 30654137, 31112940, 31171000, 31434952, 31518054		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	17715399		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	19657116, 30038265		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	16946301, 20592249, 20616219, 21835955, 22438253, 29177911, 29715199, 31687976		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	19373784, 19671192, 24236200, 25536052, 25866764		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11369512, 17075975, 17259344, 19327121, 21778049, 24658853, 25672610, 26203228, 26278330, 27066828, 27124560, 27913861, 28102846, 28223275, 28276530, 29399411, 29463989, 29741398, 29783989, 29903571, 30010038, 30034941, 30287142, 30633620, 31151472, 31316604, 31415486, 31534521, 31641797, 31752959		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17075975, 18365549		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	26203228, 30569507		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	30239650	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	33815355	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	12746476, 15048728, 37851406	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	16627550	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	LHGDN	17964871		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	35726350	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	17259344, 19553629		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	LHGDN	19017998		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	24651452, 33123122	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	25347450	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	30508148		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	14672915, 15033669, 15802268, 16322285, 17082613, 17916907, 18502034, 18701133		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17113184, 25775124, 26338423, 26494555, 28925100, 29032612, 29171984, 29745083, 31287095, 32495879, 33123122, 33637678, 34107168, 37838700	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	23690484, 26141860		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	21720246, 30903869		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	16802356, 23244336	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20722038, 23028528, 25986394, 27065298	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23764537, 27665947	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	21720246, 30903869		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16802356, 21720246, 23028528, 23244336, 27665947, 30608206, 30903869		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	16802356		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	27665947	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	21720246, 30903869		★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	12927045, 15654831, 16819541, 17032700, 17504381, 18443596, 18505078, 18781098, 18826577, 19025611, 20032431, 20181250, 20953377, 21527066, 21633638, 21738044, 21986127, 24288553, 24395653, 24672662, 24810923, 25400739, 25679210, 25735334, 25866764, 26715277, 28454081, 28559386, 28925100, 29516917, 29745083, 30251699, 33655604, 34588386, 35309836, 36419107, 36617771	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18670789, 19352387, 19550128, 30786682, 37530325	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	19148483, 22932666, 23856487, 27527412, 29434873		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	22186993, 31809874		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15454484, 17875700, 22186993, 22936065, 25704881, 29903571, 31248974, 31768009		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	19308288, 25704881, 25819228, 31378966, 31554271, 33208624, 36713377, 38036098	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	17198877	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Cutaneous Anaplastic Large Cell	Primary cutaneous anaplastic large cell lymphoma	Pubtator	19710685	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	17198877		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	LHGDN	17198877		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	17049119, 19927352, 27905003		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	27905003		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	25681335, 27935859, 30194255, 31358475		★☆☆☆☆ Found in Text Mining only
Lymphomatoid Papulosis	Lymphomatoid Papulosis	BEFREE	21982062		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	22438253, 28550161		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	18842429	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	24711662		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	35352887	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	28337946		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	21109930, 30282472		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	21380786, 26374452, 29061496, 29749473		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	28533307		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	19309551		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of adrenal cortex	Adrenocortical carcinoma	BEFREE	29088715		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	28350074		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12370187, 12626353, 12927045, 12935890, 12941798, 15029227, 15180966, 15472715, 15516962, 15805285, 15809737, 16061624, 16112111, 16172123, 16239110, 16390867, 16457694, 16836568, 17130833, 17131341, 17351259, 17517823, 17574038, 17724466, 17959712, 18270814, 18316615, 18670789, 19125297, 19196101, 19212630, 19438749, 19497995, 19500800, 19584257, 19816083, 19830694, 19927352, 20043076, 20594270, 20603605, 20798912, 21383699, 21448932, 21573501, 21617219, 21695171, 21831961, 21906588, 22152016, 22220212, 22264762, 22266857, 22432781, 22644306, 22699677, 22767589, 22884683, 22941282, 23023398, 23053995, 23647548, 23827153, 23966000, 24045366, 24101191, 24200972, 24256053, 24403602, 24448360, 24591761, 24782546, 24870556, 24906407, 24909174, 25030358, 25310198, 25321183, 25358600, 25376609, 25544759, 25753200, 25773070, 25955111, 25956853, 25978539, 26062751, 26095299, 26287601, 26356032, 26397146, 26452556, 26495998, 26576337, 26722521, 26923331, 27049755, 27157541, 27185877, 27214240, 27358402, 27461876, 27556298, 27669438, 27820834, 28012397, 28035725, 28356948, 28446538, 28534508, 28694161, 28703799, 28844962, 28929029, 28952213, 29131020, 29263923, 29339479, 29391899, 29435066, 29658570, 29682200, 29708077, 29985577, 30012106, 30015868, 30191351, 30236259, 30251699, 30259651, 30274780, 30441765, 30486409, 30564115, 30632021, 30700545, 30822630, 31010839, 31106142, 31111958, 31190884, 31388305, 31698158, 31702806, 31705019, 31737891		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	25753200		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	23985752, 26678890, 28402926		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17176471, 26130416, 28193907, 28405006, 28467773, 29208671, 31244335		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	24120239, 31244335		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	11953881, 15210854, 20578990, 21127401, 24991762, 29100374		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	26261502, 28475003		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26278330, 30569507		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16322285, 17113184, 17916907, 20147779, 20378003, 21292343, 25775124, 26141860, 26338423, 26494555, 27035564, 27845045, 28076327, 28851689, 28925100, 29171984, 29344197, 29745083, 30257500, 30355915, 31287095		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	19373784, 19671192, 24236200, 25536052, 25866764		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	28454388		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15921680, 16288025, 17173958, 21115652, 22241961, 23372646, 23924922, 24762228, 25149650, 25320277, 26235278, 28753202, 29146630, 30191987, 30822630		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10999740, 12761880, 15548713, 15662133, 15978329, 16230077, 16614115, 16752411, 18664506, 20462600, 21448932, 22450749, 22853858, 23740244, 24023356, 24033967, 24594697, 24840182, 25605248, 27267632, 28549596, 29434873, 29453972, 30940657		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11402322, 12761880, 15180966, 15328206, 15467730, 16005185, 16114056, 18337451, 18431597, 18452560, 18836306, 20043076, 20594270, 21076047, 21306303, 22245379, 23053994, 23321466, 23468933, 23788635, 23839224, 23902739, 23918819, 24525130, 24583601, 24644030, 26599430, 28466555, 28596572, 28687617, 30045021, 30111818, 30940776, 31185279, 31718684		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	BEFREE	22847686		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15867478, 19148483, 19513547, 20386750, 20651371, 20699000, 21482691, 22806902, 23023480, 24312338, 27007162, 28281844, 28481874, 28544312, 29494948, 30129184, 31244335, 31289541, 31650323		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	15184868, 27175968		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	15540205, 15582259, 22982413, 23526079, 26782415, 29022185, 29526013		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12586845, 12927045, 12935890, 15029227, 15363550, 15756007, 15809737, 15833868, 15867478, 15917309, 16125170, 16211229, 16357147, 16641550, 16823836, 16826425, 16929169, 17028596, 17041091, 17131341, 17169327, 17176471, 17270027, 17415525, 17461449, 17508279, 17574038, 17707368, 17785557, 17881971, 18155192, 18270814, 18664506, 19106094, 19148483, 19231068, 19305148, 19472013, 19500800, 19570110, 19687226, 19800199, 20043076, 20147779, 20177796, 20378003, 20484021, 20592249, 20594270, 20660740, 20865359, 20937825, 20956475, 21205837, 21672222, 21739561, 21887463, 21901619, 21934106, 22025564, 22172099, 22266857, 22644306, 22743644, 22806902, 22871210, 23023480, 23053995, 23338123, 23711392, 23734232, 23744460, 23773308, 23835861, 24012533, 24025971, 24032722, 24045366, 24553177, 24799056, 24942536, 25231113, 25310198, 25326811, 25376609, 25504108, 25647836, 25671300, 25712054, 25884903, 25978539, 26020117, 26083776, 26095299, 26141860, 26199389, 26203228, 26261502, 26299663, 26338423, 26356032, 26494555, 26495998, 26576337, 26577115, 26585400, 26599430, 26659815, 26722521, 26744523, 26923331, 26970955, 27124560, 27160279, 27212031, 27248053, 27363619, 27556298, 27634189, 27669438, 27697999, 27835894, 27930510, 28000861, 28031228, 28035725, 28176874, 28223275, 28281844, 28349828, 28410420, 28454388, 28529638, 28533307, 28544312, 28544785, 28549596, 28577295, 28581520, 28621237, 28638088, 28687617, 28694161, 28744319, 28826086, 28945785, 29088715, 29117251, 29123467, 29158842, 29162510, 29208671, 29228566, 29259008, 29282035, 29288743, 29296751, 29338191, 29348805, 29350899, 29398278, 29436696, 29494843, 29507625, 29522685, 29554149, 29696364, 29771176, 29920526, 29941486, 29973594, 30105558, 30108045, 30184109, 30224544, 30257500, 30259651, 30342024, 30349656, 30431073, 30502762, 30514601, 30569507, 30582214, 30622535, 30678736, 30729243, 30760238, 30791675, 30792442, 30883140, 30902754, 30940776, 31098995, 31185279, 31244335, 31248974, 31289212, 31292126, 31322174, 31410585, 31524789, 31545614, 31571524, 31603448, 31719921, 31747563, 31809874, 31810195, 31843463, 9858143		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28991373, 29020982, 31127849		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25114911, 27697997, 29417588		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19305148, 20460542, 20798912, 22871210, 24629239, 25232565, 25899003, 25960214, 26552750, 26678887, 27517626, 28739729, 29235568, 29907957, 31500630, 31825725		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	25753200		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12586845, 15472715, 16740704, 17889832, 21695171, 22220212, 22266857, 22842551, 25773070, 28929029, 29263923, 29321662, 29541196, 29632733, 30251699, 31460362		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12690099, 15235108, 15542430, 15805285, 16172123, 16618732, 17574038, 17763975, 17889832, 18288973, 18502034, 18570923, 18829537, 19025611		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	25753200		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	25753200		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	26350264, 28533307		★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	28577295		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	15485908, 29112684		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	15880586, 18924150, 23497290, 24632620, 25400097, 28031228, 29771176		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	LHGDN	15880586		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	23497290, 24997224, 35967388	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11571298, 15033669, 16397238, 16794396, 16929176, 17594938, 19293150, 19779716, 20061818, 22220212, 24158781, 31324252, 36923305, 38070141, 39207051	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15029227, 15059909, 15756007, 16638848, 16794396, 19305148, 25211166, 26205821, 27167239, 29767255, 30184109, 31305861, 31524789, 31788081		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15753377, 15843590, 16638848, 16929176, 17594938, 18235009, 19147814		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	17410362	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	17108064, 25227814		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	17108064, 25227814	Associate	★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	22814318		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	21294125	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19309551, 21294125, 37047331	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30811623		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	25211166		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	15180966, 24525130, 24842333		★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	30867449		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	21569821, 26659815, 28280994		★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	28559442		★☆☆☆☆ Found in Text Mining only
Motor Skills Disorders	Motor skills disorder	Pubtator	30819232	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	20720261, 27729562	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	29224811, 35154113	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25866764	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	35493524	Associate	★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	22847686, 28772134		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	28577295, 31281504		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2b	Multiple Endocrine Neoplasia	BEFREE	15485908		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11020354, 11154207, 12644822, 17686053, 21569821, 21912642, 23450831, 25526031, 26564323, 27769052, 28008160, 28042328, 28670693, 30781795, 35276027, 35731811, 35966583, 37499483, 39493694, 39503766	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	15155773, 15753365, 17119115, 18077770, 18850009, 18976811, 19139079, 21569821, 22711564, 23450831, 23456977, 23711392, 25060991, 26190113, 27697999, 27735212, 27905003, 28008160, 28042328, 28529638, 29844860, 30738861, 30781795, 30787933, 30953364, 30985424, 31325448, 31372333, 31396324, 31534632, 31672767, 31768009		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16900755, 20534452, 27519689		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	18276777, 19139298, 30160778, 31332391, 33574821, 33735664, 33795012	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	18493616, 32157826	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral	Facioscapulohumeral muscular dystrophy	Pubtator	35621301	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	22704519	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	26616645, 26826409		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	14708605	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	19020538, 22889515, 28409853		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	22889515, 32772642	Associate	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	18206727, 25193869, 25461253		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10590068, 15805265, 24502926, 24858801, 28701512		★☆☆☆☆ Found in Text Mining only
Myelokathexis	Myelokathexis	BEFREE	15026312, 16899028, 16946301, 20226738, 20592249, 20616219, 20736454, 21835955, 23009155, 23935208, 24366360, 25819228, 28928741		★☆☆☆☆ Found in Text Mining only
Myelokathexis	Myelokathexis	HPO_DG			★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	26338423		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	15550692, 17640962, 20133817, 27847151, 28154007, 28233339, 28352314, 28702143, 28716707, 28768055, 28864209, 29040423, 29996650, 30678240, 30696265, 31437601, 31495390		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	29967943, 39198660	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28961998, 31437601		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	LHGDN	15019705		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	35371068	Stimulate	★☆☆☆☆ Found in Text Mining only
Myotonia Fluctuans (disorder)	Myotonia Fluctuans	BEFREE	28903325		★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	29091208		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16000558, 18087217, 19360294, 23987636, 24170200, 26611644, 26715277, 28454388, 28559386		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	18087217, 23472069, 23987636, 24877105, 26715277, 28559386, 32521912, 33122398, 36438903	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	17075581	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12485835, 13679920, 14603250, 15026622, 15029227, 15180966, 15184868, 15201990, 15328206, 15454484, 15472715, 15540205, 15654831, 15756007, 15837989, 15880586, 15978329, 16024619, 16288036, 16322205, 16357147, 16634895, 16794396, 16823836, 16840440, 16977794, 17070589, 17108064, 17113184, 17176471, 17353903, 17415525, 17574038, 17699109, 17707368, 17724466, 17875700, 17881971, 18192232, 18696160, 18812968, 18826577, 18836306, 18957686, 18959627, 19020745, 19226458, 19305148, 19327121, 19352387, 19360294, 19438749, 19446734, 19570110, 19584257, 19584297, 19625779, 19688824, 19731977, 19777566, 19927352, 20151982, 20166978, 20386750, 20548033, 20603605, 20631066, 20660740, 20699000, 20956475, 21076047, 21171825, 21306303, 21347799, 21482691, 21538577, 21592819, 21618540, 21672222, 21909080, 22172099, 22220212, 22264762, 22266857, 22322968, 22373785, 22427929, 22463589, 22689289, 22699677, 22753736, 22767589, 22853858, 22871210, 23017139, 23023480, 23053995, 23313233, 23443279, 23468933, 23526079, 23686836, 23743303, 23744460, 23800042, 23822165, 23835861, 23856487, 24025971, 24040160, 24101191, 24238971, 24249397, 24256053, 24282276, 24290754, 24297791, 24525130, 24532280, 24590865, 24629239, 24644030, 24651452, 24728301, 24799056, 24842333, 24906407, 25114911, 25118295, 25149650, 25320277, 25359494, 25400097, 25474514, 25544759, 25613038, 25671300, 25676691, 25704881, 25712213, 25884903, 25955316, 26150700, 26190113, 26199389, 26235278, 26269531, 26299663, 26374452, 26397146, 26398122, 26406413, 26428435, 26439684, 26490988, 26577115, 26631033, 26678887, 26715277, 26745593, 26826409, 26901429, 26996301, 27301862, 27528222, 27634189, 27697997, 27697999, 27723802, 27835898, 27835905, 27863376, 27896627, 27913861, 27922681, 28042328, 28092866, 28223275, 28236984, 28263839, 28294689, 28299514, 28350074, 28378417, 28446981, 28481874, 28529632, 28529638, 28533307, 28544312, 28549419, 28549596, 28554753, 28559386, 28566721, 28621237, 28638088, 28639900, 28687617, 28733702, 28744319, 28753202, 28810154, 28835188, 28875842, 28900484, 28936810, 29017963, 29069741, 29100413, 29112684, 29146630, 29221153, 29228566, 29259008, 29280186, 29282035, 29285291, 29321662, 29348861, 29350534, 29370457, 29389241, 29399411, 29417588, 29434873, 29436696, 29455242, 29507625, 29511032, 29515781, 29544122, 29554149, 29581772, 29696364, 29706375, 29734183, 29745083, 29845707, 29887884, 29903571, 29926386, 29959873, 29985577, 30010038, 30012106, 30022623, 30108045, 30149659, 30191987, 30287142, 30319622, 30319638, 30342023, 30385376, 30431073, 30479461, 30502762, 30504836, 30549315, 30622535, 30642351, 30700545, 30789971, 30802149, 30857971, 30862718, 30874597, 30883140, 30940657, 30999154, 31022852, 31193811, 31201250, 31221512, 31239269, 31239542, 31248974, 31263828, 31293645, 31336612, 31344595, 31384667, 31388305, 31423170, 31428099, 31451931, 31494293, 31494331, 31524789, 31537527, 31562188, 31571016, 31603448, 31605845, 31611940, 31620068, 31624136, 31641797, 31653903, 31661001, 31705019, 31719921, 31802362, 31812931, 31843463, 9881942		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	27960539		★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	CTD_human_DG	30818366		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nervous System Diseases	Nervous system disease	Pubtator	23916293	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	10871762		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10820198, 16001969, 18083706, 20028517, 22916293, 24376734, 24452472, 25503960, 25527973, 25774696, 29051534, 35942521	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	LHGDN	15486895		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17325742, 18214604, 18292939, 21906874, 22916293, 24399074, 25774696, 25955316, 29051534, 29259008, 29436676, 30149659		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	19106094, 33219123, 39991734	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	19106094, 29636460		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	28186979, 31451931		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	29455242		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	29455242		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	29020982, 29455242		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	29515781, 31620068		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	23434321, 28055968, 29020982	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	16946301, 20592249, 20616219, 29177911		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	19043667, 35493524, 35525891, 36883568	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	35525891	Associate	★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	17548653, 29177911		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12626353, 16322285, 16929169, 18502034, 18575756, 20147779, 20378003, 21292343, 22370645, 23443279, 24025971, 25609202, 26141860, 26150700, 26280082, 26338423, 26782435, 27581786, 27822706, 27922681, 28000861, 28733702, 28925100, 29344197, 29721166, 29745083, 29972256, 30076481, 30128017, 30257500, 30355915		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	24997224		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	15026622		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	LHGDN	15026622		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23349771, 28687617		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23349771, 37063877	Associate	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	10585143	Stimulate	★☆☆☆☆ Found in Text Mining only
Opitz GBBB Syndrome, X-Linked	Opitz GBBB Syndrome, X-Linked	BEFREE	28469774		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	11817585, 27356492, 30942441, 32101839, 37291167	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	32978834	Associate	★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis Imperfecta	BEFREE	23197643		★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	18337451	Associate	★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	30267402		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30737274		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28576885, 29882473		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	LHGDN	15701832, 15814634, 18339860		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15814634, 17360650, 18339860, 23845465, 24040160, 24618817, 25444927, 25890096, 25997540, 26026718, 26546437, 28038429, 28468584, 29523218, 29734183, 29845707, 31193811, 31437795, 31571016		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24618817, 25890096, 26546437, 28468584, 29734183, 31983166, 38129870, 40699365	Associate	★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	29568908		★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	28478265		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15921680, 16288025, 17173958, 21115652, 22241961, 23372646, 24762228, 25149650, 25320277, 26235278, 28753202, 29146630, 30191987, 30802149, 30822630		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17459055, 20460402, 21115652, 21527066, 21738044, 22025564, 22200669, 22549810, 24408020, 25712684, 26819076, 32977853, 33829065, 35397601, 37644468	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25514788	Stimulate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	29221153		★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	23835861		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10999740, 15548713, 15662133, 16230077, 16614115, 18664506, 20462600, 21448932, 22450749, 22853858, 23740244, 24023356, 24033967, 24594697, 24840182, 25605248, 27267632, 28549596, 29434873, 29453972, 30940657		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic diseases	Pubtator	21045835	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30902754, 31432181		★☆☆☆☆ Found in Text Mining only
Pancreatic Endocrine Carcinoma	Pancreatic Endocrine Carcinoma	BEFREE	31239269		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	16230077, 17379424, 18175225, 19002187		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	22116519, 27609457		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12761880, 15662133, 17560257, 19002187, 19035451, 19352387, 20426768, 20798912, 21045835, 21448932, 22220212, 22377565, 22450749, 22472349, 22995914, 23740244, 24068191, 24175834, 24998559, 25240521, 25609203, 25970774, 26010611, 28356064, 32867211, 35119076, 35259193, 35797269, 37697316, 38036098	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17012836, 31584877	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	20564084, 36142575	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	15184868, 18089812, 18696160, 18826577, 19731977, 21909080, 23918302, 24992171, 25326811, 29424203		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	29163802		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	24041428, 37461070	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	19551455, 29257331, 29636460, 30428473, 31535659, 31831012		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34528139	Associate	★☆☆☆☆ Found in Text Mining only
Parotitis	Parotitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	22206707		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	30940657		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	16045736		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	16045736	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	21382035, 28326928		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34859622, 36148415, 38206700	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	31070930		★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	19688824	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	33655604	Associate	★☆☆☆☆ Found in Text Mining only
Pharyngitis	Pharyngitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	22203494		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	18698020		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	18698020, 23895705, 32224525	Associate	★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504, 26387944		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504, 26387944		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	31186083	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35689735	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	38243290	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	35771847	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	15019705		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	16236608, 25072364, 27686375, 30453100, 31346528, 31809874		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	16679918, 17488655		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	18322253, 26058075, 26058076, 26931577, 27686375, 28979681, 30422351, 31809874		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	28478265		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	16944452		★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	20592249		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	16990584, 18206727, 18511598, 20858855, 25193869, 25461253		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	LHGDN	17350297, 18206727, 18511598		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	29636460		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11402322, 15180966, 15328206, 15467730, 16005185, 16114056, 18337451, 18431597, 18452560, 18836306, 20043076, 20594270, 21076047, 21306303, 22245379, 23053994, 23321466, 23468933, 23788635, 23839224, 23902739, 23918819, 24583601, 24644030, 26599430, 28466555, 28596572, 28687617, 30045021, 30111818, 30940776, 31185279, 31718684		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	11912162, 12761880, 15180966, 15328206, 15467730, 15844659, 16114056, 16969502, 18201276, 18337451, 18431597		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12761880, 15467730, 16756721, 16859559, 17034033, 18201276, 18337451, 18431597, 18452560, 18836306, 19460858, 21076047, 21156016, 21627959, 22074556, 22245379, 22271494, 23315288, 23468933, 23839224, 23918819, 24583601, 25359780, 26499200, 26599430, 29330286, 30111818, 33569050, 37996444, 38087324, 39207051	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	22245379, 23321466, 29396484		★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	23835861		★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	23528817		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31287410		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	24114538, 26903201		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29805477		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17050556, 37838700	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19218194, 23009155, 33116473	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24742278	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	39328420	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	15286810, 19433312, 23710557, 28979687, 29453386, 29499695, 29777878, 31501415		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	20646340	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	20177796		★☆☆☆☆ Found in Text Mining only
Refractory anemia with ringed sideroblasts	Anemia With Ringed Sideroblasts	BEFREE	19692701		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	31081041		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	11953881, 15210854, 20578990, 21127401, 24991762, 27638770, 29100374		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15210854, 17083723, 19796655, 20578990, 21127401, 22972438, 24012533, 24032722, 24327013, 26439684, 27634189, 27638770, 28279221, 28846693, 30985424, 31494331		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	27960539		★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	28739729		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28815665		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28126341		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	28126341, 28447713, 30479013, 31322174		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor Predisposition Syndrome 1	Rhabdoid tumor predisposition syndrome	Pubtator	26998479	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	LHGDN	12239174, 17768666, 18593989		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	12239174, 20068066, 26037167	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	20068066, 26037167, 31428099		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	12239174	Stimulate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	15184910	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11086103, 11817585, 12096225, 16775617, 19800199, 20346245, 20617529, 21724701, 23710557, 24516346, 27385284, 28833034, 29456830, 31066041, 31081041, 31820725		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	19017998		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	19192274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	33836777	Associate	★☆☆☆☆ Found in Text Mining only
Right ventricular failure	Ventricular Failure	BEFREE	28209402		★☆☆☆☆ Found in Text Mining only
Rigid spine syndrome	Rigid spine muscular dystrophy	Pubtator	24997224	Associate	★☆☆☆☆ Found in Text Mining only
Roberts Syndrome	Roberts syndrome	Pubtator	33319833	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	28772134		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	20169144	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	26696750		★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	26696750	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	18083706	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	19107931		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	20864684		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	15183454, 20525755, 23075330, 24651452, 26428435, 28549419, 29776413, 31810195	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	15110993	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	25613038	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	24101523, 25464914, 30233327		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	24578173, 25986394, 29566745	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	27503580		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	23495012, 32615059	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	35583012	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	17075377, 28562124, 29232699, 29777009		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	15454484, 18171296		★☆☆☆☆ Found in Text Mining only
Severe combined immunodeficiency due to adenosine deaminase deficiency	Severe combined immunodeficiency	Pubtator	24465884	Associate	★☆☆☆☆ Found in Text Mining only
Severe periodontitis	Periodontitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	16204308, 28694325, 31106661	Associate	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	36171622	Stimulate	★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	12879309, 31034775		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	15986367	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	31287410	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	33243845	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	14603250, 19455144, 20147779, 25504108, 27835905, 28299514, 30076481		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	25671300	Stimulate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	26823791, 26843617, 28299514	Associate	★☆☆☆☆ Found in Text Mining only
Speech Disorders	Speech Disorders	HPO_DG			★☆☆☆☆ Found in Text Mining only
SPINAL MUSCULAR ATROPHY WITH RESPIRATORY DISTRESS 1	SPINAL MUSCULAR ATROPHY WITH RESPIRATORY DISTRESS	BEFREE	31445043		★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	24500843	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	25506924, 25853812	Associate	★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	22220212		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	14567988, 15201990, 15363550, 15492752, 16327980, 17634424, 18487224, 19082444		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15201990, 16327980, 18487224, 18781098, 19212630, 19570110, 19671192, 21205837, 22847686, 28547946, 29797610, 30076481, 30554431, 30874597		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17176471, 23744460, 23822165, 25631630, 26577115, 26631033		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18781098, 20695076, 21205837, 22384257, 26232325, 31263828, 33655604, 34741382, 35309836, 35978426, 36300800, 36834729	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25866764	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	38096163	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29088715, 30076481		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	18781098		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	15363550, 15837745, 21380786, 25474514, 26374452, 29061496, 29348861		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	18487224		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	30554431, 31011147		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	30342381		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	12093767		★☆☆☆☆ Found in Text Mining only
Stickler syndrome, type 1	Stickler syndrome	BEFREE	19777566		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15654831, 15867478, 19148483, 19513547, 20386750, 20651371, 20699000, 21482691, 22337890, 22806902, 23023480, 24312338, 27007162, 28281844, 28481874, 28544312, 28544785, 29494948, 30129184, 31244335, 31289541, 31650323		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15654831, 15867478, 19688824, 20032431, 20386750, 21443538, 21633638, 21880153, 22337890, 23936528, 24312338, 24929539, 25400739, 26823797, 28489887, 31240220, 31517442, 31855733, 32306562, 32881844, 33110054, 33661721, 34322132, 34348580, 34957697, 35388021, 36171622, 36564369, 37036489, 37629071	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15867478, 18219852, 18949410		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	30760287	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30117729		★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	28271184, 35842134	Associate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	25613038, 30431073		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	29968759	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	16948134, 29566745		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	16948134, 18556411		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	22264762		★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	34906163	Associate	★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	19006565	Inhibit	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	19006565		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	24035716, 34289017	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	20009035		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	21110890	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	26826409		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	29112684	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	16203990, 20306451	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	18826577, 21909080, 23918302, 24288553, 25326811, 27082011, 33522355, 34588386, 35786050, 36512648	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	15184868, 27175968		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	11443213		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	12519884, 18089812, 18696160		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	15184868, 21909080, 27175968		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	21909080, 27082011, 35799158, 36419107, 39187346	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	11966764, 39187346	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	29424203		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	21178277, 21506920		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	19500800, 24256053, 25420519, 25544759, 27669438, 28356948, 28528184, 29317253, 29416611, 29926386, 29973594, 30237308, 30564115, 30642351, 31074257, 31190884, 31737891		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24356721, 31924747, 36209974, 38111587	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34224371	Stimulate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	20865359, 24687413, 29218082		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22736438, 23526079, 23886194, 32228629	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	22958742	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	16977794, 17032700, 19308288, 19574782, 22958742, 25114911, 35083551	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	17410362, 20036848, 23164171, 26490988	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	18235009, 20036848, 24052640, 26490988, 30563937		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	15153539		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	37042831	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	16343467, 19059114		★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	10942389	Associate	★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	31595394	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	28716707	Associate	★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	19493998		★☆☆☆☆ Found in Text Mining only
Vipoma	Vipoma	Pubtator	23231927	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	HPO_DG			★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	17070589, 17083723, 24138046		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	18448868, 19394082, 24553177, 24573383, 24711662, 24786453, 24912431, 25212891, 25371371, 25819228, 25853747, 26199389, 26490317, 26659815, 27059040, 27268124, 27287071, 27301862, 27825465, 27825467, 27836860, 27890075, 28280994, 28294689, 28366781, 28548645, 28983055, 29222280, 29661775, 29742593, 30183082, 30190015, 31221512, 31267520, 31343930, 31571524		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	LHGDN	18448868		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	18448868, 21106070, 24366360, 24553177, 24786453, 25371371, 25853747, 25893290, 26002963, 26659815, 27301862, 28235842, 28548645, 28983055, 30183082, 31221512, 31267520, 32457988, 32822482, 33713429, 33735664, 34289017, 34462944, 35877223, 36210485, 36282673, 36325357, 37088135, 38211337	Associate	★☆☆☆☆ Found in Text Mining only
WHIM syndrome	Whim syndrome	Pubtator	15026312, 15536153, 15781337, 16899028, 17270027, 18436740, 18556651, 19043667, 19956569, 20148920, 20226738, 20736454, 21890643, 22596258, 23009155, 23734232, 24366360, 24489825, 24553177, 25514788, 25819228, 26002963, 26659815, 30625055, 30819232, 31652152, 32870250, 33415666, 33485325, 34697698, 34807749, 34973340, 35154113, 35493524, 35525891, 35588454, 35947323, 36089616, 36883568, 37561579, 37989463	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	19774680		★☆☆☆☆ Found in Text Mining only