Gene Gene information from NCBI Gene database.
Entrez ID 785
Gene name Calcium voltage-gated channel auxiliary subunit beta 4
Gene symbol CACNB4
Synonyms (NCBI Gene)
CAB4CACNLB4EA5EIG9EJMEJM4EJM6
Chromosome 2
Chromosome location 2q23.3
Summary This gene encodes a member of the beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, b
SNPs SNP information provided by dbSNP.
10
SNP ID Visualize variation Clinical significance Consequence
rs1805031 C>A Pathogenic, uncertain-significance, conflicting-interpretations-of-pathogenicity, risk-factor 5 prime UTR variant, coding sequence variant, missense variant, non coding transcript variant
rs1805032 G>A Risk-factor Stop gained, coding sequence variant, genic downstream transcript variant, non coding transcript variant
rs200092211 G>A Likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity Non coding transcript variant, upstream transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs200662010 G>C Likely-benign, conflicting-interpretations-of-pathogenicity, uncertain-significance Non coding transcript variant, upstream transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs542973906 G>A Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance Genic upstream transcript variant, non coding transcript variant, coding sequence variant, upstream transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
139
miRTarBase ID miRNA Experiments Reference
MIRT030091 hsa-miR-26b-5p Sequencing 20371350
MIRT739410 hsa-miR-4802-3p HITS-CLIP 33718276
MIRT857912 hsa-miR-103a CLIP-seq
MIRT857913 hsa-miR-107 CLIP-seq
MIRT857914 hsa-miR-1183 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
48
GO ID Ontology Definition Evidence Reference
GO:0005245 Function Voltage-gated calcium channel activity IDA 16525042
GO:0005245 Function Voltage-gated calcium channel activity IEA
GO:0005246 Function Calcium channel regulator activity IDA 11880487
GO:0005262 Function Calcium channel activity IEA
GO:0005515 Function Protein binding IPI 16525042, 25910212, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601949 1404 ENSG00000182389
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O00305
Protein name Voltage-dependent L-type calcium channel subunit beta-4 (CAB4) (Calcium channel voltage-dependent subunit beta 4)
Protein function The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and c
PDB 2D46
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12052 VGCC_beta4Aa_N 50 91 Voltage gated calcium channel subunit beta domain 4Aa N terminal Domain
PF00625 Guanylate_kin 218 398 Guanylate kinase Domain
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in the cerebellum and kidney.
Sequence
MSSSSYAKNGTADGPHSPTSQVARGTTTRRSRLKRSDGSTTSTSFILRQGSADSYTSRPS
DSDVSLEEDREAIRQEREQQAAIQLERAKSK
PVAFAVKTNVSYCGALDEDVPVPSTAISF
DAKDFLHIKEKYNNDWWIGRLVKEGCEIGFIPSPLRLENIRIQQEQKRGRFHGGKSSGNS
SSSLGEMVSGTFRATPTSTAKQKQKVTEHIPPYDVVPSMRPVVLVGPSLKGYEVTDMMQK
ALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRSSLAEVQSEIERIF
ELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRGKSQSKHLNVQ
LVAADKLAQCPPEMFDVILDENQLEDACEHLGEYLEAY
WRATHTTSSTPMTPLLGRNLGS
TALSPYPTAISGLQSQRMRHSNHSTENSPIERRSLMTSDENYHNERARKSRNRLSSSSQH
SRDHYPLVEEDYPDSYQDTYKPHRNRGSPGGYSHDSRHRL
Sequence length 520
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy
Arrhythmogenic right ventricular cardiomyopathy
Dilated cardiomyopathy
  Presynaptic depolarization and calcium channel opening
Phase 0 - rapid depolarisation
Phase 2 - plateau phase
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
25
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Epilepsy, idiopathic generalized, susceptibility to, 9 Pathogenic rs1057518688 RCV000414849
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Spastic ataxia Likely pathogenic rs2151410142 RCV001647152
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ATAXIA CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CACNB4-related disorder Likely benign; Benign; Conflicting classifications of pathogenicity; Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alopecia Alopecia BEFREE 24025145
★☆☆☆☆
Found in Text Mining only
Cardiomyopathy, Familial Idiopathic Cardiomyopathy GWASCAT_DG 29495422
★☆☆☆☆
Found in Text Mining only
Cerebellar Diseases Cerebellar diseases Pubtator 35256372 Associate
★☆☆☆☆
Found in Text Mining only
Dysarthria Dysarthria HPO_DG
★☆☆☆☆
Found in Text Mining only
Epilepsy Epilepsy CLINGEN_DG 10762541, 18755274, 24875574, 27959697, 9039265, 9442082
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Epilepsy Epilepsy BEFREE 24875574, 28587927
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Epilepsy Epilepsy Pubtator 31056551, 35256372 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Epilepsy Absence Absence epilepsy Pubtator 20561025 Associate
★☆☆☆☆
Found in Text Mining only
Epilepsy Temporal Lobe Temporal lobe epilepsy Pubtator 35256372 Associate
★☆☆☆☆
Found in Text Mining only
Epilepsy, Akinetic Epilepsy CTD_human_DG 10762541
★☆☆☆☆
Found in Text Mining only