LAPTM5 (lysosomal protein transmembrane 5)

Gene

• Entrez ID: 7805
• Gene name: Lysosomal protein transmembrane 5
• Gene symbol: LAPTM5
• Synonyms (NCBI Gene): CLAST6
• Chromosome: 1
• Chromosome location: 1p35.2
• Summary: This gene encodes a transmembrane receptor that is associated with lysosomes. The encoded protein, also known as E3 protein, may play a role in hematopoiesis. [provided by RefSeq, Feb 2009]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018494	hsa-miR-335-5p	Microarray	18185580
MIRT447286	hsa-miR-4446-3p	PAR-CLIP	22100165
MIRT447285	hsa-miR-3918	PAR-CLIP	22100165
MIRT447284	hsa-miR-4680-3p	PAR-CLIP	22100165
MIRT447283	hsa-miR-4656	PAR-CLIP	22100165
MIRT447282	hsa-miR-3127-5p	PAR-CLIP	22100165
MIRT447281	hsa-miR-1273e	PAR-CLIP	22100165
MIRT447280	hsa-miR-6885-3p	PAR-CLIP	22100165
MIRT447279	hsa-miR-129-5p	PAR-CLIP	22100165
MIRT447286	hsa-miR-4446-3p	PAR-CLIP	22100165
MIRT447285	hsa-miR-3918	PAR-CLIP	22100165
MIRT447284	hsa-miR-4680-3p	PAR-CLIP	22100165
MIRT447283	hsa-miR-4656	PAR-CLIP	22100165
MIRT447282	hsa-miR-3127-5p	PAR-CLIP	22100165
MIRT447281	hsa-miR-1273e	PAR-CLIP	22100165
MIRT447280	hsa-miR-6885-3p	PAR-CLIP	22100165
MIRT447279	hsa-miR-129-5p	PAR-CLIP	22100165
MIRT447286	hsa-miR-4446-3p	PAR-CLIP	22100165
MIRT447285	hsa-miR-3918	PAR-CLIP	22100165
MIRT447284	hsa-miR-4680-3p	PAR-CLIP	22100165
MIRT447283	hsa-miR-4656	PAR-CLIP	22100165
MIRT447282	hsa-miR-3127-5p	PAR-CLIP	22100165
MIRT447281	hsa-miR-1273e	PAR-CLIP	22100165
MIRT447280	hsa-miR-6885-3p	PAR-CLIP	22100165
MIRT447279	hsa-miR-129-5p	PAR-CLIP	22100165
MIRT447286	hsa-miR-4446-3p	PAR-CLIP	22100165
MIRT447285	hsa-miR-3918	PAR-CLIP	22100165
MIRT447284	hsa-miR-4680-3p	PAR-CLIP	22100165
MIRT447283	hsa-miR-4656	PAR-CLIP	22100165
MIRT447282	hsa-miR-3127-5p	PAR-CLIP	22100165
MIRT447281	hsa-miR-1273e	PAR-CLIP	22100165
MIRT447280	hsa-miR-6885-3p	PAR-CLIP	22100165
MIRT447279	hsa-miR-129-5p	PAR-CLIP	22100165
MIRT1104156	hsa-miR-1269	CLIP-seq
MIRT1104157	hsa-miR-1269b	CLIP-seq
MIRT1104158	hsa-miR-1288	CLIP-seq
MIRT1104159	hsa-miR-22	CLIP-seq
MIRT1104160	hsa-miR-2355-5p	CLIP-seq
MIRT1104161	hsa-miR-3064-3p	CLIP-seq
MIRT1104162	hsa-miR-3176	CLIP-seq
MIRT1104163	hsa-miR-3545-3p	CLIP-seq
MIRT1104164	hsa-miR-3922-3p	CLIP-seq
MIRT1104165	hsa-miR-4515	CLIP-seq
MIRT1104166	hsa-miR-4539	CLIP-seq
MIRT1104167	hsa-miR-4646-5p	CLIP-seq
MIRT1104168	hsa-miR-4724-5p	CLIP-seq
MIRT1104169	hsa-miR-4740-5p	CLIP-seq
MIRT1104170	hsa-miR-661	CLIP-seq
MIRT1920582	hsa-miR-34c-3p	CLIP-seq
MIRT1920583	hsa-miR-4452	CLIP-seq
MIRT1920584	hsa-miR-4778-5p	CLIP-seq
MIRT1920582	hsa-miR-34c-3p	CLIP-seq
MIRT1920583	hsa-miR-4452	CLIP-seq
MIRT1920584	hsa-miR-4778-5p	CLIP-seq
MIRT2028481	hsa-miR-1204	CLIP-seq
MIRT2028482	hsa-miR-1972	CLIP-seq
MIRT2028483	hsa-miR-3605-3p	CLIP-seq
MIRT2028484	hsa-miR-4257	CLIP-seq
MIRT2028485	hsa-miR-4419a	CLIP-seq
MIRT2028486	hsa-miR-4459	CLIP-seq
MIRT2028487	hsa-miR-4510	CLIP-seq
MIRT2028488	hsa-miR-4691-3p	CLIP-seq
MIRT2028489	hsa-miR-4722-5p	CLIP-seq
MIRT2028490	hsa-miR-4731-3p	CLIP-seq
MIRT2028491	hsa-miR-4757-5p	CLIP-seq
MIRT2028492	hsa-miR-4789-5p	CLIP-seq
MIRT2028493	hsa-miR-4801	CLIP-seq
MIRT2028494	hsa-miR-765	CLIP-seq
MIRT2028494	hsa-miR-765	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002357	Process	Defense response to tumor cell	IDA	19787053
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	IEA
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	ISS	8661146
GO:0005515	Function	Protein binding	IPI	17116753, 21224396, 25416956, 32296183
GO:0005764	Component	Lysosome	IDA	8661146, 22096579, 28464033
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IDA	17116753
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA	8661146
GO:0006622	Process	Protein targeting to lysosome	IEA
GO:0006622	Process	Protein targeting to lysosome	ISS	8661146
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006886	Process	Intracellular protein transport	ISS	8661146
GO:0012502	Process	Induction of programmed cell death	IDA	19787053
GO:0016020	Component	Membrane	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0030133	Component	Transport vesicle	IDA	19787053
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	ISS	8661146
GO:0031410	Component	Cytoplasmic vesicle	IDA	22009753
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	17116753, 22009753
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032689	Process	Negative regulation of type II interferon production	ISS	8661146
GO:0032703	Process	Negative regulation of interleukin-2 production	IEA
GO:0032703	Process	Negative regulation of interleukin-2 production	ISS	8661146
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS	8661146
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032991	Component	Protein-containing complex	IDA	17116753
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	ISS	8661146
GO:0046007	Process	Negative regulation of activated T cell proliferation	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	28464033
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IEA
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	ISS	8661146
GO:0050868	Process	Negative regulation of T cell activation	IEA
GO:0050868	Process	Negative regulation of T cell activation	ISS	8661146
GO:0050869	Process	Negative regulation of B cell activation	IEA
GO:0050869	Process	Negative regulation of B cell activation	ISS	8661146
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	ISS	8661146
GO:0061462	Process	Protein localization to lysosome	IEA
GO:0090160	Process	Golgi to lysosome transport	IEA
GO:0090160	Process	Golgi to lysosome transport	ISS	8661146
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IDA	28464033
GO:0097214	Process	Positive regulation of lysosomal membrane permeability	IDA	19787053
GO:0140311	Function	Protein sequestering activity	IEA
GO:0140311	Function	Protein sequestering activity	ISS	8661146
GO:0140646	Process	Negative regulation of pre-B cell receptor expression	IEA
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	ISS	8661146
GO:1903052	Process	Positive regulation of proteolysis involved in protein catabolic process	IEA
GO:1903265	Process	Positive regulation of tumor necrosis factor-mediated signaling pathway	IEA
GO:1903265	Process	Positive regulation of tumor necrosis factor-mediated signaling pathway	ISS	8661146
GO:1904093	Process	Negative regulation of autophagic cell death	IDA	19787053
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IEA
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	ISS	8661146
GO:2000646	Process	Positive regulation of receptor catabolic process	IEA
GO:2000646	Process	Positive regulation of receptor catabolic process	ISS	8661146

Other IDs

• MIM: 601476
• HGNC: 29612
• e!Ensembl: ENSG00000162511

Protein

• UniProt ID: Q13571
• Protein name: Lysosomal-associated transmembrane protein 5 (Lysosomal-associated multitransmembrane protein 5) (Retinoic acid-inducible E3 protein)
• Protein function: May have a special functional role during embryogenesis and in adult hematopoietic cells.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03821	Mtp	28 → 261	Golgi 4-transmembrane spanning transporter	Family

• Tissue specificity: TISSUE SPECIFICITY: Preferentially expressed in adult hematopoietic tissues. High levels in lymphoid and myeloid tissues. Highly expressed in peripheral blood leukocytes, thymus, spleen and lung, followed by placenta, liver and kidney. {ECO:0000269|PubMed
• Sequence:

  MDPRLSTVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRI
  ADLISSFLLITMLFIISLSLLIGVVKNREKYLLPFLSLQIMDYLLCLLTLLGSYIELPAY
  LKLASRSRASSSKFPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMP
  HNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRLIKCMNSVEEKRNSKMLQKVVLPSYE
  EALSLPSKTPEGGPAPPPYSEV

• Sequence length: 262

Pathways

KEGG:

Lysosome

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
IGA GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Atherosclerosis	Atherosclerosis	Pubtator	34925641	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	35919038, 36226239	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27922670		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35294039, 36799186	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27058622	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36037300	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27922670		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33428598	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36154667	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27058622	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31701625		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	19787053	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	35157609	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	35157609	Stimulate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	CTD_human_DG	25133636		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	35842443	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	25928846	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	25998573		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	25998573		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12527926		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27922670		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12527926		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12886255		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	16504146	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	34922439	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	36466903	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26903547		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19787053, 22009753	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	27058622	Inhibit	★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	12527926		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	35711523	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37410084	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	34922439	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	26903547		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	26903547	Associate	★☆☆☆☆ Found in Text Mining only