Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	780
Gene name	Discoidin domain receptor tyrosine kinase 1
Gene symbol	DDR1
Synonyms (NCBI Gene)	CAKCD167DDREDDR1HGK2MCK10NEPNTRK4PTK3PTK3ARTK6TRKE
Chromosome	6
Chromosome location	6p21.33
Summary	Receptor tyrosine kinases play a key role in the communication of cells with their microenvironment. These kinases are involved in the regulation of cell growth, differentiation and metabolism. The protein encoded by this gene belongs to a subfamily of ty

258

Show/Hide all (258)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004674	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCRWestern blot	20799954
MIRT004674	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCRWestern blot	20799954
MIRT004674	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCRWestern blot	20799954
MIRT004674	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCRWestern blot	20799954
MIRT006812	hsa-miR-199b-5p	ImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	22374871
MIRT006812	hsa-miR-199b-5p	ImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	22374871
MIRT017205	hsa-miR-335-5p	Microarray	18185580
MIRT004674	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCRWestern blot	26655502
MIRT929456	hsa-miR-125a-3p	CLIP-seq
MIRT929457	hsa-miR-1825	CLIP-seq
MIRT929458	hsa-miR-1908	CLIP-seq
MIRT929459	hsa-miR-3134	CLIP-seq
MIRT929460	hsa-miR-361-3p	CLIP-seq
MIRT929461	hsa-miR-3934	CLIP-seq
MIRT929462	hsa-miR-4489	CLIP-seq
MIRT929463	hsa-miR-4508	CLIP-seq
MIRT929464	hsa-miR-4534	CLIP-seq
MIRT929465	hsa-miR-4640-3p	CLIP-seq
MIRT929466	hsa-miR-4726-3p	CLIP-seq
MIRT929467	hsa-miR-4802-5p	CLIP-seq
MIRT929468	hsa-miR-663	CLIP-seq
MIRT929469	hsa-miR-744	CLIP-seq
MIRT929470	hsa-miR-764	CLIP-seq
MIRT929471	hsa-miR-765	CLIP-seq
MIRT929472	hsa-miR-1207-3p	CLIP-seq
MIRT929473	hsa-miR-1224-5p	CLIP-seq
MIRT929474	hsa-miR-1237	CLIP-seq
MIRT929475	hsa-miR-1238	CLIP-seq
MIRT929476	hsa-miR-1248	CLIP-seq
MIRT929477	hsa-miR-1252	CLIP-seq
MIRT929456	hsa-miR-125a-3p	CLIP-seq
MIRT929478	hsa-miR-1273	CLIP-seq
MIRT929479	hsa-miR-1293	CLIP-seq
MIRT929480	hsa-miR-130a	CLIP-seq
MIRT929481	hsa-miR-130b	CLIP-seq
MIRT929482	hsa-miR-134	CLIP-seq
MIRT929457	hsa-miR-1825	CLIP-seq
MIRT929483	hsa-miR-185	CLIP-seq
MIRT929458	hsa-miR-1908	CLIP-seq
MIRT929484	hsa-miR-1909	CLIP-seq
MIRT929485	hsa-miR-198	CLIP-seq
MIRT929486	hsa-miR-2355-3p	CLIP-seq
MIRT929487	hsa-miR-2467-3p	CLIP-seq
MIRT929488	hsa-miR-301a	CLIP-seq
MIRT929489	hsa-miR-301b	CLIP-seq
MIRT929490	hsa-miR-3118	CLIP-seq
MIRT929459	hsa-miR-3134	CLIP-seq
MIRT929491	hsa-miR-3135	CLIP-seq
MIRT929492	hsa-miR-3136-5p	CLIP-seq
MIRT929493	hsa-miR-3152-5p	CLIP-seq
MIRT929494	hsa-miR-3179	CLIP-seq
MIRT929495	hsa-miR-3180	CLIP-seq
MIRT929496	hsa-miR-3180-3p	CLIP-seq
MIRT929497	hsa-miR-3183	CLIP-seq
MIRT929498	hsa-miR-3185	CLIP-seq
MIRT929499	hsa-miR-3196	CLIP-seq
MIRT929500	hsa-miR-3202	CLIP-seq
MIRT929501	hsa-miR-337-3p	CLIP-seq
MIRT929502	hsa-miR-3591-5p	CLIP-seq
MIRT929460	hsa-miR-361-3p	CLIP-seq
MIRT929503	hsa-miR-3616-3p	CLIP-seq
MIRT929504	hsa-miR-3655	CLIP-seq
MIRT929505	hsa-miR-3657	CLIP-seq
MIRT929506	hsa-miR-3666	CLIP-seq
MIRT929507	hsa-miR-3909	CLIP-seq
MIRT929461	hsa-miR-3934	CLIP-seq
MIRT929508	hsa-miR-4261	CLIP-seq
MIRT929509	hsa-miR-4269	CLIP-seq
MIRT929510	hsa-miR-4271	CLIP-seq
MIRT929511	hsa-miR-4280	CLIP-seq
MIRT929512	hsa-miR-4282	CLIP-seq
MIRT929513	hsa-miR-4289	CLIP-seq
MIRT929514	hsa-miR-4295	CLIP-seq
MIRT929515	hsa-miR-4306	CLIP-seq
MIRT929516	hsa-miR-4436b-3p	CLIP-seq
MIRT929517	hsa-miR-4439	CLIP-seq
MIRT929518	hsa-miR-4446-3p	CLIP-seq
MIRT929519	hsa-miR-4450	CLIP-seq
MIRT929520	hsa-miR-4457	CLIP-seq
MIRT929521	hsa-miR-4476	CLIP-seq
MIRT929522	hsa-miR-4483	CLIP-seq
MIRT929462	hsa-miR-4489	CLIP-seq
MIRT929523	hsa-miR-4492	CLIP-seq
MIRT929524	hsa-miR-4496	CLIP-seq
MIRT929525	hsa-miR-4498	CLIP-seq
MIRT929526	hsa-miR-4505	CLIP-seq
MIRT929463	hsa-miR-4508	CLIP-seq
MIRT929527	hsa-miR-4513	CLIP-seq
MIRT929528	hsa-miR-4533	CLIP-seq
MIRT929464	hsa-miR-4534	CLIP-seq
MIRT929529	hsa-miR-454	CLIP-seq
MIRT929465	hsa-miR-4640-3p	CLIP-seq
MIRT929530	hsa-miR-4640-5p	CLIP-seq
MIRT929531	hsa-miR-4644	CLIP-seq
MIRT929532	hsa-miR-4649-5p	CLIP-seq
MIRT929533	hsa-miR-4661-3p	CLIP-seq
MIRT929534	hsa-miR-4669	CLIP-seq
MIRT929535	hsa-miR-4671-3p	CLIP-seq
MIRT929536	hsa-miR-4690-5p	CLIP-seq
MIRT929537	hsa-miR-4693-3p	CLIP-seq
MIRT929538	hsa-miR-4700-3p	CLIP-seq
MIRT929539	hsa-miR-4711-3p	CLIP-seq
MIRT929540	hsa-miR-4712-3p	CLIP-seq
MIRT929541	hsa-miR-4721	CLIP-seq
MIRT929542	hsa-miR-4723-3p	CLIP-seq
MIRT929543	hsa-miR-4725-3p	CLIP-seq
MIRT929466	hsa-miR-4726-3p	CLIP-seq
MIRT929544	hsa-miR-4726-5p	CLIP-seq
MIRT929545	hsa-miR-4731-5p	CLIP-seq
MIRT929546	hsa-miR-4747-5p	CLIP-seq
MIRT929547	hsa-miR-4751	CLIP-seq
MIRT929548	hsa-miR-4773	CLIP-seq
MIRT929549	hsa-miR-4795-3p	CLIP-seq
MIRT929550	hsa-miR-4796-5p	CLIP-seq
MIRT929467	hsa-miR-4802-5p	CLIP-seq
MIRT929551	hsa-miR-494	CLIP-seq
MIRT929552	hsa-miR-541	CLIP-seq
MIRT929553	hsa-miR-548c-3p	CLIP-seq
MIRT929554	hsa-miR-556-3p	CLIP-seq
MIRT929555	hsa-miR-574-5p	CLIP-seq
MIRT929556	hsa-miR-578	CLIP-seq
MIRT929557	hsa-miR-592	CLIP-seq
MIRT929558	hsa-miR-593	CLIP-seq
MIRT929559	hsa-miR-599	CLIP-seq
MIRT929560	hsa-miR-654-5p	CLIP-seq
MIRT929468	hsa-miR-663	CLIP-seq
MIRT929561	hsa-miR-665	CLIP-seq
MIRT929562	hsa-miR-676	CLIP-seq
MIRT929469	hsa-miR-744	CLIP-seq
MIRT929563	hsa-miR-762	CLIP-seq
MIRT929470	hsa-miR-764	CLIP-seq
MIRT929471	hsa-miR-765	CLIP-seq
MIRT929474	hsa-miR-1237	CLIP-seq
MIRT929476	hsa-miR-1248	CLIP-seq
MIRT929457	hsa-miR-1825	CLIP-seq
MIRT929485	hsa-miR-198	CLIP-seq
MIRT929486	hsa-miR-2355-3p	CLIP-seq
MIRT929504	hsa-miR-3655	CLIP-seq
MIRT1975216	hsa-miR-3907	CLIP-seq
MIRT929507	hsa-miR-3909	CLIP-seq
MIRT929530	hsa-miR-4640-5p	CLIP-seq
MIRT929544	hsa-miR-4726-5p	CLIP-seq
MIRT929556	hsa-miR-578	CLIP-seq
MIRT929562	hsa-miR-676	CLIP-seq
MIRT929472	hsa-miR-1207-3p	CLIP-seq
MIRT929479	hsa-miR-1293	CLIP-seq
MIRT929457	hsa-miR-1825	CLIP-seq
MIRT1975217	hsa-miR-3168	CLIP-seq
MIRT929502	hsa-miR-3591-5p	CLIP-seq
MIRT1975218	hsa-miR-4302	CLIP-seq
MIRT929522	hsa-miR-4483	CLIP-seq
MIRT1975219	hsa-miR-4699-3p	CLIP-seq
MIRT929472	hsa-miR-1207-3p	CLIP-seq
MIRT2210591	hsa-miR-1287	CLIP-seq
MIRT929479	hsa-miR-1293	CLIP-seq
MIRT929480	hsa-miR-130a	CLIP-seq
MIRT929481	hsa-miR-130b	CLIP-seq
MIRT929457	hsa-miR-1825	CLIP-seq
MIRT2210592	hsa-miR-2276	CLIP-seq
MIRT929488	hsa-miR-301a	CLIP-seq
MIRT929489	hsa-miR-301b	CLIP-seq
MIRT2210593	hsa-miR-3145-5p	CLIP-seq
MIRT2210594	hsa-miR-3154	CLIP-seq
MIRT2210595	hsa-miR-3184	CLIP-seq
MIRT929506	hsa-miR-3666	CLIP-seq
MIRT2210596	hsa-miR-423-5p	CLIP-seq
MIRT929514	hsa-miR-4295	CLIP-seq
MIRT2210597	hsa-miR-4434	CLIP-seq
MIRT929522	hsa-miR-4483	CLIP-seq
MIRT2210598	hsa-miR-4516	CLIP-seq
MIRT929529	hsa-miR-454	CLIP-seq
MIRT929535	hsa-miR-4671-3p	CLIP-seq
MIRT2210599	hsa-miR-4688	CLIP-seq
MIRT1975219	hsa-miR-4699-3p	CLIP-seq
MIRT2210600	hsa-miR-4728-5p	CLIP-seq
MIRT2210601	hsa-miR-4764-5p	CLIP-seq
MIRT2210602	hsa-miR-486-3p	CLIP-seq
MIRT2210603	hsa-miR-508-5p	CLIP-seq
MIRT929472	hsa-miR-1207-3p	CLIP-seq
MIRT929457	hsa-miR-1825	CLIP-seq
MIRT929540	hsa-miR-4712-3p	CLIP-seq
MIRT929479	hsa-miR-1293	CLIP-seq
MIRT929482	hsa-miR-134	CLIP-seq
MIRT929457	hsa-miR-1825	CLIP-seq
MIRT929458	hsa-miR-1908	CLIP-seq
MIRT929490	hsa-miR-3118	CLIP-seq
MIRT929492	hsa-miR-3136-5p	CLIP-seq
MIRT929495	hsa-miR-3180	CLIP-seq
MIRT929496	hsa-miR-3180-3p	CLIP-seq
MIRT929499	hsa-miR-3196	CLIP-seq
MIRT929503	hsa-miR-3616-3p	CLIP-seq
MIRT929505	hsa-miR-3657	CLIP-seq
MIRT929517	hsa-miR-4439	CLIP-seq
MIRT929518	hsa-miR-4446-3p	CLIP-seq
MIRT929522	hsa-miR-4483	CLIP-seq
MIRT929462	hsa-miR-4489	CLIP-seq
MIRT929523	hsa-miR-4492	CLIP-seq
MIRT929525	hsa-miR-4498	CLIP-seq
MIRT929526	hsa-miR-4505	CLIP-seq
MIRT929463	hsa-miR-4508	CLIP-seq
MIRT929527	hsa-miR-4513	CLIP-seq
MIRT929534	hsa-miR-4669	CLIP-seq
MIRT929541	hsa-miR-4721	CLIP-seq
MIRT929545	hsa-miR-4731-5p	CLIP-seq
MIRT929468	hsa-miR-663	CLIP-seq
MIRT929469	hsa-miR-744	CLIP-seq
MIRT929563	hsa-miR-762	CLIP-seq
MIRT929457	hsa-miR-1825	CLIP-seq
MIRT929483	hsa-miR-185	CLIP-seq
MIRT929485	hsa-miR-198	CLIP-seq
MIRT2514546	hsa-miR-3151	CLIP-seq
MIRT2514547	hsa-miR-320e	CLIP-seq
MIRT1975216	hsa-miR-3907	CLIP-seq
MIRT2514548	hsa-miR-3925-3p	CLIP-seq
MIRT2514549	hsa-miR-4270	CLIP-seq
MIRT1975218	hsa-miR-4302	CLIP-seq
MIRT929515	hsa-miR-4306	CLIP-seq
MIRT2514550	hsa-miR-4441	CLIP-seq
MIRT2514551	hsa-miR-4488	CLIP-seq
MIRT929530	hsa-miR-4640-5p	CLIP-seq
MIRT929531	hsa-miR-4644	CLIP-seq
MIRT2514552	hsa-miR-4691-3p	CLIP-seq
MIRT2514553	hsa-miR-4697-5p	CLIP-seq
MIRT929466	hsa-miR-4726-3p	CLIP-seq
MIRT929544	hsa-miR-4726-5p	CLIP-seq
MIRT929545	hsa-miR-4731-5p	CLIP-seq
MIRT929550	hsa-miR-4796-5p	CLIP-seq
MIRT2514554	hsa-miR-637	CLIP-seq
MIRT929561	hsa-miR-665	CLIP-seq
MIRT929470	hsa-miR-764	CLIP-seq
MIRT2514555	hsa-miR-766	CLIP-seq
MIRT929457	hsa-miR-1825	CLIP-seq
MIRT929483	hsa-miR-185	CLIP-seq
MIRT929485	hsa-miR-198	CLIP-seq
MIRT2514546	hsa-miR-3151	CLIP-seq
MIRT2514547	hsa-miR-320e	CLIP-seq
MIRT929501	hsa-miR-337-3p	CLIP-seq
MIRT1975216	hsa-miR-3907	CLIP-seq
MIRT2514548	hsa-miR-3925-3p	CLIP-seq
MIRT2514549	hsa-miR-4270	CLIP-seq
MIRT2679143	hsa-miR-4286	CLIP-seq
MIRT1975218	hsa-miR-4302	CLIP-seq
MIRT929515	hsa-miR-4306	CLIP-seq
MIRT2514550	hsa-miR-4441	CLIP-seq
MIRT2514551	hsa-miR-4488	CLIP-seq
MIRT929530	hsa-miR-4640-5p	CLIP-seq
MIRT929531	hsa-miR-4644	CLIP-seq
MIRT2514552	hsa-miR-4691-3p	CLIP-seq
MIRT2514553	hsa-miR-4697-5p	CLIP-seq
MIRT2679144	hsa-miR-4713-5p	CLIP-seq
MIRT929466	hsa-miR-4726-3p	CLIP-seq
MIRT929544	hsa-miR-4726-5p	CLIP-seq
MIRT929545	hsa-miR-4731-5p	CLIP-seq
MIRT929550	hsa-miR-4796-5p	CLIP-seq
MIRT2514554	hsa-miR-637	CLIP-seq
MIRT929561	hsa-miR-665	CLIP-seq
MIRT929470	hsa-miR-764	CLIP-seq
MIRT2514555	hsa-miR-766	CLIP-seq

Show/Hide all (57)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001558	Process	Regulation of cell growth	IEA
GO:0001952	Process	Regulation of cell-matrix adhesion	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	TAS	9659899
GO:0005515	Function	Protein binding	IPI	16337946, 18190796, 32296183, 33961781, 35384245
GO:0005518	Function	Collagen binding	IBA
GO:0005518	Function	Collagen binding	IDA	9659899
GO:0005518	Function	Collagen binding	IEA
GO:0005518	Function	Collagen binding	IMP	12065315
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8390675
GO:0007155	Process	Cell adhesion	TAS	8302582
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0007566	Process	Embryo implantation	IEA
GO:0007595	Process	Lactation	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0010715	Process	Regulation of extracellular matrix disassembly	IEA
GO:0010715	Process	Regulation of extracellular matrix disassembly	IMP	12065315
GO:0010976	Process	Positive regulation of neuron projection development	IBA
GO:0014909	Process	Smooth muscle cell migration	IEA
GO:0014909	Process	Smooth muscle cell migration	IMP	12065315
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0038062	Function	Protein tyrosine kinase collagen receptor activity	IBA
GO:0038062	Function	Protein tyrosine kinase collagen receptor activity	IDA	9659899, 21044884
GO:0038062	Function	Protein tyrosine kinase collagen receptor activity	IEA
GO:0038063	Process	Collagen-activated tyrosine kinase receptor signaling pathway	IDA	9659899, 21044884
GO:0038063	Process	Collagen-activated tyrosine kinase receptor signaling pathway	IEA
GO:0038063	Process	Collagen-activated tyrosine kinase receptor signaling pathway	IMP	12065315
GO:0038083	Process	Peptidyl-tyrosine autophosphorylation	IDA	21044884
GO:0043235	Component	Receptor complex	IBA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043583	Process	Ear development	IEA
GO:0044319	Process	Wound healing, spreading of cells	IEA
GO:0044319	Process	Wound healing, spreading of cells	IMP	12065315
GO:0046777	Process	Protein autophosphorylation	IDA	9659899
GO:0046872	Function	Metal ion binding	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0060444	Process	Branching involved in mammary gland duct morphogenesis	IEA
GO:0060749	Process	Mammary gland alveolus development	IEA
GO:0061302	Process	Smooth muscle cell-matrix adhesion	IEA
GO:0061302	Process	Smooth muscle cell-matrix adhesion	IMP	12065315
GO:0061564	Process	Axon development	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:1990138	Process	Neuron projection extension	IEA

MIM	HGNC	e!Ensembl
600408	2730	ENSG00000204580

Q08345

Protein name

Epithelial discoidin domain-containing receptor 1 (Epithelial discoidin domain receptor 1) (EC 2.7.10.1) (CD167 antigen-like family member A) (Cell adhesion kinase) (Discoidin receptor tyrosine kinase) (HGK2) (Mammary carcinoma kinase 10) (MCK-10) (Protei

Protein function

Tyrosine kinase that functions as a cell surface receptor for fibrillar collagen and regulates cell attachment to the extracellular matrix, remodeling of the extracellular matrix, cell migration, differentiation, survival and cell proliferation.

PDB

3ZOS , 4AG4 , 4BKJ , 4CKR , 5BVK , 5BVN , 5BVO , 5BVW , 5FDP , 5FDX , 5SAU , 5SAV , 5SAW , 5SAX , 5SAY , 5SAZ , 5SB0 , 5SB1 , 5SB2 , 6BRJ , 6BSD , 6FEW , 6FEX , 6FIL , 6FIN , 6FIO , 6FIQ , 6GWR , 6HP9 , 6Y23 , 7BCM , 7BE6 , 7FEH , 8PE9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00754	F5_F8_type_C	46 → 182	F5/8 type C domain	Domain
PF07714	PK_Tyr_Ser-Thr	610 → 905	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in T-47D, MDA-MB-175 and HBL-100 breast carcinoma cells, A-431 epidermoid carcinoma cells, SW48 and SNU-C2B colon carcinoma cells and Hs 294T melanoma cells (at protein level). Expressed at low levels in most adult tissues and

Sequence

MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR
HSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRL
RYSRDGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRV
ELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDD
FRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGG
VECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFS
EISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI
GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPRE
PPPYQEPRPRGNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNT
QAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGP
PRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPD
ATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLED
KAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTI
KIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLC
RAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQ
LHRFLAEDALNTV

Sequence length

913

Interactions

View interactions

	Reactome
			Non-integrin membrane-ECM interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (32)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHONDRODYSPLASIA	—	Disgenet, GenCC Disgenet, GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIATIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (221)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	16243790, 30783426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	20596615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	20596615, 26855149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30783426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	24136166, 24357706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alloimmunisation	Alloimmunisation	BEFREE	15464186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alport Syndrome	Alport Syndrome	BEFREE	20307660, 30452219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37194065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	24723326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	24723326	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	20941644, 30593950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	40401507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26297342, 30131383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	11804980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	24361528, 28743124, 29859097, 29930002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	GWASCAT_DG	30552173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22380734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	15111304, 18065762, 24768818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24361528, 28743124, 29859097, 29930002		★★★★★ ★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	21382117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30890477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia Nonobstructive	Nonobstructive azoospermia	Pubtator	25064398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia, Nonobstructive	Azoospermia	BEFREE	25064398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	30514066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	38395959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28560000, 9252693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	11126911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	37147958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26655502, 28591735, 29467865, 29486622, 30121624, 31130862, 31578591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16440311, 25155634, 25667101, 25774665, 26655502, 28591735, 32668815, 36484686	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	40536885	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	20596615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	24136166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21398698, 26286316, 31253192, 32716315, 37117273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17970783, 25667101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	25824769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20799954, 29559654, 32090682, 32716315, 34335575, 34664394, 34815375, 35140331, 37117273, 39284684	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	25667101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28560000, 9252693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17707548, 22223527, 25992553, 27384677, 31807189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	GWASCAT_DG	28604730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28887161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26297342	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33213062, 34688654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27020590, 27220961, 31018949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28743276, 28887161, 7789998, 7848919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	11804980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	11126911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	21382117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	28540026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30783426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	40401507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Infantile Neurological, Cutaneous, and Articular Syndrome	Neurological, Cutaneous And Articular Syndrome	BEFREE	12928894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28536691, 28743124, 29455614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	21356365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31116512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32090682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24711074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23899692, 35593476, 35969377, 37271822	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11804980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28809959, 31018949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cortical cataract	Cortical cataract	BEFREE	17466625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24361528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29930002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	37446387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	19591919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	19591919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	31537649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	25427824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	17704737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28887161, 7789998, 7848919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	19019493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	34403736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	11839585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11126911, 30917320, 31117874, 31746375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31117874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11126911, 30917320, 31117874, 31746375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	16652150, 2531122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37147958, 38177123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	22751008, 29859097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	17466625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	31717573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11804980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	24136166, 24357706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	24136166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31207434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	22751008, 30826571, 30929513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26286316	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	15879152, 16507902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	16507902, 26956955, 30119248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	16507902		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	20372823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	BEFREE	15213330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28536691, 28743124, 29455614, 31260458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	27020590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21398698, 24519883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	2531122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	24519883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	18270328, 22374871, 24519883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24519883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31253192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	37768856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	37768856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17982627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20799954, 25842034, 29559654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	11839585	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	15136580, 21356365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	21356365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	21356365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	39284684	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	20799954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	16507902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	LHGDN	16507902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	16507902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21398698, 22522909, 23374247, 24768818, 27384677	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	21552421		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	22223527, 27384677		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	22751008, 28391340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	15111304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27020590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	24136166		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	Pubtator	24136166	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Macular Degeneration	Macular degeneration	Pubtator	23455636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	31717573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	25369402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25840417, 26655502, 28591735, 29483153, 29486622, 30121624, 31130862, 31578591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	25427824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	20459800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31807189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17707548, 22223527, 25992553, 27384677, 31807189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31253192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28743276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28368050, 31291716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14550292, 14968440, 17415380, 17970783, 31836603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	24763052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28143619, 29547756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30121624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28560000, 9252693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16912190, 17970783, 20596615, 23761027, 25840417, 25992553, 26655502, 27589335, 28199848, 28591735, 29486622, 29505315, 29859097, 30187813, 30954568 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31116512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17027969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29298894, 31578591, 8622863		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17207277, 30651597, 31271515		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	31108116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	27384677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	27384677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	34815375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	15929037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	31253192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27718532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27718532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31321514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18023033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11126911, 17207277, 17299390, 17415380, 20459800, 20799954, 21541037, 22223527, 23686701, 24357706, 25369402, 25667101, 26286316, 27384677, 28143619 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28507471, 29550247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17299390, 18083107, 20596615, 23761027, 30076413, 31269869, 31659178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	25667101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	25064398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29039472		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15240533		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28743276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21541037	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28743276, 34837026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28368050, 31291716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26297342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	28864681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27605668, 28368050, 33213062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	39713856	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	28809959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	29866925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	29866925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	26286316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	17001518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	26286316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	31260458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	31260458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	21356365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14550292, 14968440, 17970783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17970783		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23661456, 32492656	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	24763052		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30119248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	20459800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	20307660, 30954571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	22751008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	35957513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	17804836, 19503088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17440435, 18836851, 30597424		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	17440435		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	17440435		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	28540026		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	38395959	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	29438985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	31253192		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30691832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31253192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31717573		★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	30284298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28143619, 29547756, 29866925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	29547756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29866925, 35935941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	GWASCAT_DG	25604533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30121624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	30121624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichothiodystrophy Syndromes	Trichothiodystrophy	BEFREE	18077223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25155634, 25667101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25667101, 28270498, 31578591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29232715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33234027	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	20182441, 25613741, 26091274, 30890477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	20182441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	20182441, 25613741, 26091274, 30890477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	18077223		★★★★★ ★☆☆☆☆ Found in Text Mining only

DDR1 (discoidin domain receptor tyrosine kinase 1)