Gene Gene information from NCBI Gene database.
Entrez ID 7791
Gene name Zyxin
Gene symbol ZYX
Synonyms (NCBI Gene)
ESP-2HED-2
Chromosome 7
Chromosome location 7q34
Summary Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin is a zinc-binding phosphoprotein that concentrates at focal adhesions and alon
miRNA miRNA information provided by mirtarbase database.
75
miRTarBase ID miRNA Experiments Reference
MIRT006534 hsa-miR-16-5p Luciferase reporter assayqRT-PCRWestern blot 21360639
MIRT006534 hsa-miR-16-5p Luciferase reporter assayqRT-PCRWestern blot 21360639
MIRT006534 hsa-miR-16-5p Luciferase reporter assayqRT-PCRWestern blot 21360639
MIRT006534 hsa-miR-16-5p Luciferase reporter assayqRT-PCRWestern blot 21360639
MIRT007089 hsa-miR-16-1-3p qRT-PCR 23175429
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0001725 Component Stress fiber IBA
GO:0001725 Component Stress fiber IDA 18297730, 24036928
GO:0003723 Function RNA binding HDA 22658674
GO:0005515 Function Protein binding IPI 10801818, 10831611, 23840749, 25416956, 26871637, 28514442, 29892012, 31413325, 31515488, 32296183, 33961781
GO:0005634 Component Nucleus IDA 24036928
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602002 13200 ENSG00000159840
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15942
Protein name Zyxin (Zyxin-2)
Protein function Adhesion plaque protein. Binds alpha-actinin and the CRP protein. Important for targeting TES and ENA/VASP family members to focal adhesions and for the formation of actin-rich structures. May be a component of a signal transduction pathway that
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00412 LIM 384 441 LIM domain Domain
PF00412 LIM 444 500 LIM domain Domain
PF00412 LIM 504 570 LIM domain Domain
Sequence
MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRV
GEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPP
PEEEGGPEAPIPPPPQPREKVSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATP
FSSKSSTKPAAGGTAPLPPWKSPSSSQPLPQVPAPAQSQTQFHVQPQPQPKPQVQLHVQS
QTQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPE
ALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELE
QLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQ
GQQFYSLEGAPYCEGCYTDTL
EKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGT
SFIVDQANRPHCVPDYHKQY
APRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDC
GKPLSIEADDNGCFPLDGHVLCRKCHTARA
QT
Sequence length 572
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Focal adhesion
Cytoskeleton in muscle cells
 
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
COLORECTAL NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Sarcoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 23330981, 33712570 Associate
★☆☆☆☆
Found in Text Mining only
Asthma Asthma BEFREE 28278518
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 27030211
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 35740950 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 16680155, 35769513, 37547758 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of larynx Laryngeal carcinoma BEFREE 21360639
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 22778267, 30600590
★☆☆☆☆
Found in Text Mining only
Cardiomyopathy Dilated Dilated cardiomyopathy Pubtator 27837684 Inhibit
★☆☆☆☆
Found in Text Mining only
Cardiomyopathy, Familial Idiopathic Cardiomyopathy BEFREE 27837684
★☆☆☆☆
Found in Text Mining only
Colon Carcinoma Colon Carcinoma BEFREE 16959042, 29967145, 31501460
★☆☆☆☆
Found in Text Mining only