SLC30A3 (solute carrier family 30 member 3)

Gene

• Entrez ID: 7781
• Gene name: Solute carrier family 30 member 3
• Gene symbol: SLC30A3
• Synonyms (NCBI Gene): ZNT3
• Chromosome: 2
• Chromosome location: 2p23.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT607465	hsa-miR-8485	HITS-CLIP	23824327
MIRT634030	hsa-miR-548aa	HITS-CLIP	23824327
MIRT634029	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT634028	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT607465	hsa-miR-8485	HITS-CLIP	23824327
MIRT634030	hsa-miR-548aa	HITS-CLIP	23824327
MIRT634029	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT634028	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT607465	hsa-miR-8485	HITS-CLIP	23824327
MIRT634030	hsa-miR-548aa	HITS-CLIP	23824327
MIRT634029	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT634028	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT607465	hsa-miR-8485	HITS-CLIP	23824327
MIRT666287	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT634030	hsa-miR-548aa	HITS-CLIP	23824327
MIRT634029	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT634028	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT666286	hsa-miR-497-3p	HITS-CLIP	23824327
MIRT607465	hsa-miR-8485	HITS-CLIP	23824327
MIRT653635	hsa-miR-7846-3p	HITS-CLIP	23824327
MIRT653633	hsa-miR-211-3p	HITS-CLIP	23824327
MIRT653632	hsa-miR-4270	HITS-CLIP	23824327
MIRT653631	hsa-miR-4441	HITS-CLIP	23824327
MIRT653630	hsa-miR-6754-5p	HITS-CLIP	23824327
MIRT653629	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT653627	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT653628	hsa-miR-4469	HITS-CLIP	23824327
MIRT653626	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT666285	hsa-miR-1184	HITS-CLIP	23824327
MIRT653625	hsa-miR-1289	HITS-CLIP	23824327
MIRT653624	hsa-miR-3127-5p	HITS-CLIP	23824327
MIRT653623	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT653622	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT653635	hsa-miR-7846-3p	HITS-CLIP	23824327
MIRT653633	hsa-miR-211-3p	HITS-CLIP	23824327
MIRT653632	hsa-miR-4270	HITS-CLIP	23824327
MIRT653631	hsa-miR-4441	HITS-CLIP	23824327
MIRT653630	hsa-miR-6754-5p	HITS-CLIP	23824327
MIRT653629	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT653627	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT653628	hsa-miR-4469	HITS-CLIP	23824327
MIRT653626	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT653625	hsa-miR-1289	HITS-CLIP	23824327
MIRT653624	hsa-miR-3127-5p	HITS-CLIP	23824327
MIRT653623	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT653622	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT634030	hsa-miR-548aa	HITS-CLIP	23824327
MIRT634029	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT634028	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT607465	hsa-miR-8485	HITS-CLIP	23824327
MIRT607465	hsa-miR-8485	HITS-CLIP	24906430
MIRT576714	hsa-miR-548aa	HITS-CLIP	27418678
MIRT576713	hsa-miR-548ap-3p	HITS-CLIP	27418678
MIRT576712	hsa-miR-548t-3p	HITS-CLIP	27418678
MIRT576711	hsa-miR-8485	HITS-CLIP	27418678
MIRT576711	hsa-miR-8485	HITS-CLIP	27418678
MIRT734618	hsa-miR-5572	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	32599739
MIRT576711	hsa-miR-8485	HITS-CLIP	23824327
MIRT576714	hsa-miR-548aa	HITS-CLIP	23824327
MIRT576713	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT576712	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT576711	hsa-miR-8485	HITS-CLIP	23824327
MIRT576714	hsa-miR-548aa	HITS-CLIP	23824327
MIRT576713	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT576712	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT576711	hsa-miR-8485	HITS-CLIP	23824327
MIRT576714	hsa-miR-548aa	HITS-CLIP	23824327
MIRT576713	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT576712	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT576711	hsa-miR-8485	HITS-CLIP	23824327
MIRT666287	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT576714	hsa-miR-548aa	HITS-CLIP	23824327
MIRT576713	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT576712	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT666286	hsa-miR-497-3p	HITS-CLIP	23824327
MIRT576711	hsa-miR-8485	HITS-CLIP	23824327
MIRT653635	hsa-miR-7846-3p	HITS-CLIP	23824327
MIRT653633	hsa-miR-211-3p	HITS-CLIP	23824327
MIRT653632	hsa-miR-4270	HITS-CLIP	23824327
MIRT653631	hsa-miR-4441	HITS-CLIP	23824327
MIRT653630	hsa-miR-6754-5p	HITS-CLIP	23824327
MIRT653629	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT653627	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT653628	hsa-miR-4469	HITS-CLIP	23824327
MIRT653626	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT666285	hsa-miR-1184	HITS-CLIP	23824327
MIRT653625	hsa-miR-1289	HITS-CLIP	23824327
MIRT653624	hsa-miR-3127-5p	HITS-CLIP	23824327
MIRT653623	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT653622	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT653635	hsa-miR-7846-3p	HITS-CLIP	23824327
MIRT653633	hsa-miR-211-3p	HITS-CLIP	23824327
MIRT653632	hsa-miR-4270	HITS-CLIP	23824327
MIRT653631	hsa-miR-4441	HITS-CLIP	23824327
MIRT653630	hsa-miR-6754-5p	HITS-CLIP	23824327
MIRT653629	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT653627	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT653628	hsa-miR-4469	HITS-CLIP	23824327
MIRT653626	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT653625	hsa-miR-1289	HITS-CLIP	23824327
MIRT653624	hsa-miR-3127-5p	HITS-CLIP	23824327
MIRT653623	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT653622	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT576714	hsa-miR-548aa	HITS-CLIP	23824327
MIRT576713	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT576712	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT576711	hsa-miR-8485	HITS-CLIP	23824327
MIRT1359120	hsa-miR-1193	CLIP-seq
MIRT1359121	hsa-miR-1207-5p	CLIP-seq
MIRT1359122	hsa-miR-29a	CLIP-seq
MIRT1359123	hsa-miR-29b	CLIP-seq
MIRT1359124	hsa-miR-29c	CLIP-seq
MIRT1359125	hsa-miR-3065-3p	CLIP-seq
MIRT1359126	hsa-miR-3165	CLIP-seq
MIRT1359127	hsa-miR-342-5p	CLIP-seq
MIRT1359128	hsa-miR-34a	CLIP-seq
MIRT1359129	hsa-miR-34c-5p	CLIP-seq
MIRT1359130	hsa-miR-3616-3p	CLIP-seq
MIRT1359131	hsa-miR-376c	CLIP-seq
MIRT1359132	hsa-miR-3918	CLIP-seq
MIRT1359133	hsa-miR-4313	CLIP-seq
MIRT1359134	hsa-miR-4436b-3p	CLIP-seq
MIRT1359135	hsa-miR-449a	CLIP-seq
MIRT1359136	hsa-miR-449b	CLIP-seq
MIRT1359137	hsa-miR-4514	CLIP-seq
MIRT1359138	hsa-miR-4633-3p	CLIP-seq
MIRT1359139	hsa-miR-4643	CLIP-seq
MIRT1359140	hsa-miR-4651	CLIP-seq
MIRT1359141	hsa-miR-4662a-5p	CLIP-seq
MIRT1359142	hsa-miR-4664-5p	CLIP-seq
MIRT1359143	hsa-miR-4692	CLIP-seq
MIRT1359144	hsa-miR-4710	CLIP-seq
MIRT1359145	hsa-miR-4717-3p	CLIP-seq
MIRT1359146	hsa-miR-4721	CLIP-seq
MIRT1359147	hsa-miR-4731-3p	CLIP-seq
MIRT1359148	hsa-miR-4763-3p	CLIP-seq
MIRT1359149	hsa-miR-4801	CLIP-seq
MIRT1359150	hsa-miR-4802-3p	CLIP-seq
MIRT1359151	hsa-miR-490-5p	CLIP-seq
MIRT1359152	hsa-miR-558	CLIP-seq
MIRT1359153	hsa-miR-608	CLIP-seq
MIRT1359154	hsa-miR-642a	CLIP-seq
MIRT1359155	hsa-miR-642b	CLIP-seq
MIRT2106343	hsa-miR-1972	CLIP-seq
MIRT1359122	hsa-miR-29a	CLIP-seq
MIRT1359123	hsa-miR-29b	CLIP-seq
MIRT1359124	hsa-miR-29c	CLIP-seq
MIRT1359125	hsa-miR-3065-3p	CLIP-seq
MIRT1359126	hsa-miR-3165	CLIP-seq
MIRT2106344	hsa-miR-3622a-5p	CLIP-seq
MIRT2106345	hsa-miR-4423-3p	CLIP-seq
MIRT1359138	hsa-miR-4633-3p	CLIP-seq
MIRT1359141	hsa-miR-4662a-5p	CLIP-seq
MIRT2106346	hsa-miR-4717-5p	CLIP-seq
MIRT1359147	hsa-miR-4731-3p	CLIP-seq
MIRT1359149	hsa-miR-4801	CLIP-seq
MIRT1359152	hsa-miR-558	CLIP-seq
MIRT1359154	hsa-miR-642a	CLIP-seq
MIRT1359122	hsa-miR-29a	CLIP-seq
MIRT1359123	hsa-miR-29b	CLIP-seq
MIRT1359124	hsa-miR-29c	CLIP-seq
MIRT1359125	hsa-miR-3065-3p	CLIP-seq
MIRT2442637	hsa-miR-1224-3p	CLIP-seq
MIRT2442638	hsa-miR-1260	CLIP-seq
MIRT2442639	hsa-miR-1260b	CLIP-seq
MIRT2442640	hsa-miR-1280	CLIP-seq
MIRT2442641	hsa-miR-4258	CLIP-seq
MIRT2442642	hsa-miR-4286	CLIP-seq
MIRT2459663	hsa-miR-4283	CLIP-seq
MIRT2459664	hsa-miR-4489	CLIP-seq
MIRT2459665	hsa-miR-4492	CLIP-seq
MIRT2459666	hsa-miR-4498	CLIP-seq
MIRT2459667	hsa-miR-4505	CLIP-seq
MIRT2459668	hsa-miR-4656	CLIP-seq
MIRT2459669	hsa-miR-4731-5p	CLIP-seq
MIRT2459670	hsa-miR-762	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005385	Function	Zinc ion transmembrane transporter activity	IBA
GO:0005385	Function	Zinc ion transmembrane transporter activity	IDA	17349999, 19521526, 26647834
GO:0005385	Function	Zinc ion transmembrane transporter activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 25657003, 26728129, 32296183, 33961781, 36204728
GO:0005737	Component	Cytoplasm	IDA	17349999
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IDA	17349999
GO:0005886	Component	Plasma membrane	IBA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006812	Process	Monoatomic cation transport	IEA
GO:0006829	Process	Zinc ion transport	IEA
GO:0008021	Component	Synaptic vesicle	IDA	26647834
GO:0008021	Component	Synaptic vesicle	TAS	8962159
GO:0008324	Function	Monoatomic cation transmembrane transporter activity	IEA
GO:0010043	Process	Response to zinc ion	IBA
GO:0015297	Function	Antiporter activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031902	Component	Late endosome membrane	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0045202	Component	Synapse	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051050	Process	Positive regulation of transport	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0062111	Process	Zinc ion import into organelle	IEA
GO:0071577	Process	Zinc ion transmembrane transport	IBA
GO:0071577	Process	Zinc ion transmembrane transport	IDA	19521526
GO:0071577	Process	Zinc ion transmembrane transport	IMP	26647834
GO:0097457	Component	Hippocampal mossy fiber	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099180	Process	Zinc ion import into synaptic vesicle	IEA
GO:0140916	Process	Zinc ion import into lysosome	IDA	17349999
GO:1990742	Component	Microvesicle	IEA

Other IDs

• MIM: 602878
• HGNC: 11014
• e!Ensembl: ENSG00000115194

Protein

• UniProt ID: Q99726
• Protein name: Probable proton-coupled zinc antiporter SLC30A3 (Solute carrier family 30 member 3) (Zinc transporter 3) (ZnT-3)
• Protein function: Probable proton-coupled zinc ion antiporter mediating the import of zinc from cytoplasm into synaptic vesicles and participating to cellular zinc ion homeostasis in the brain. {ECO:0000269|PubMed:17349999, ECO:0000269|PubMed:19521526, ECO:000026
• PDB: 8XN1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01545	Cation_efflux	76 → 293	Cation efflux family	Family

• Sequence:

  MEPSPAAGGLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPL
  PPPGLTPERLHARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSL
  FSLWLSTRPATRTMTFGWHRSETLGALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAM
  LLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEEGPEEPLPLGNTSVRAAFVHVL
  GDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGSTAPTLRDVLRILMEGTPRNV
  GFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRF
  GFSSCTLQVEQYQPEMAQCLRCQEPPQA

• Sequence length: 388

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FEBRILE CONVULSIONS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Febrile seizure (within the age range of 3 months to 6 years)	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	22640423	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	25284286, 27678294		★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	32599739	Inhibit	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	25284286		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	27790247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	15056725		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	27790247		★☆☆☆☆ Found in Text Mining only
Convulsions in the newborn	Convulsions	BEFREE	31551684		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	27790247		★☆☆☆☆ Found in Text Mining only
Delusions	Delusions	BEFREE	29856089		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	27661418	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21866305		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	GWASCAT_DG	27790247		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21866305		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	GWASCAT_DG	27790247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Febrile Convulsions	Febrile seizures	BEFREE	26647834		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	GWASCAT_DG	27790247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Neoplasms	Malignant Neoplasm	GWASCAT_DG	27790247		★☆☆☆☆ Found in Text Mining only
Mucolipidosis Type IV	Mucolipidosis	BEFREE	30914059		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28956834		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	27678294		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30914059		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	23849395, 27750116		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	23849395		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Senile Plaques	Senile Plaques	BEFREE	20164588		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29287786, 29687372		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29992050		★☆☆☆☆ Found in Text Mining only