Gene Gene information from NCBI Gene database.
Entrez ID 7755
Gene name Zinc finger protein 205
Gene symbol ZNF205
Synonyms (NCBI Gene)
RhitHZNF210Zfp13
Chromosome 16
Chromosome location 16p13.3
miRNA miRNA information provided by mirtarbase database.
10
miRTarBase ID miRNA Experiments Reference
MIRT2156314 hsa-miR-3124-3p CLIP-seq
MIRT2156315 hsa-miR-3178 CLIP-seq
MIRT2156316 hsa-miR-4292 CLIP-seq
MIRT2156317 hsa-miR-4486 CLIP-seq
MIRT2375896 hsa-miR-1225-3p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
FOXP3 Unknown 22306510
GABPA Unknown 22306510
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 22306510
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603436 12996 ENSG00000122386
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95201
Protein name Transcriptional repressor RHIT (Repressor of heat-inducible transcription) (RhitH) (Zinc finger protein 205) (Zinc finger protein 210)
Protein function Transcriptional repressor involved in regulating MPV17L expression (PubMed:22306510). By regulating MPV17L expression, contributes to the regulation of genes involved in H(2)O(2) metabolism and the mitochondrial apoptotic cascade (PubMed:2230651
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 123 162 KRAB box Family
PF00096 zf-C2H2 308 330 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 336 358 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 364 386 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 392 414 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 420 442 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 448 470 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 476 498 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 504 526 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, skeletal muscle, pancreas and brain. Weakly expressed in placenta, lung, liver, kidney and thymus.
Sequence
MSADGGGIQDTQDKETPPEVPDRGHPHQEMPSKLGEAVPSGDTQESLHIKMEPEEPHSEG
ASQEDGAQGAWGWAPLSHGSKEKALFLPGGALPSPRIPVLSREGRTRDRQMAAALLTAWS
QMPVTFEDVALYLSREEWGRLDHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHGKGEA
SGSSRQAGDEKEWRGACTGAVEVGQRVQTSSVAALGNVKPFRTRAGRVQWGVPQCAQEAA
CGRSSGPAKDSGQPAEPDRTPDAAPPDPSPTEPQEYRVPEKPNEEEKGAPESGEEGLAPD
SEVGRKSYRCEQCGKGFSWHSHLVTHRRTHTGEKPYACTDCGKRFGRSSHLIQHQIIHTG
EKPYTCPACRKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPH
KCPICAKCFTQSSALVTHQRTH
TGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLD
CGKSFSHSSHLTAHQRTH
RGVRPYACPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGA
AAAGALATPPPAPT
Sequence length 554
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
POLYCYSTIC OVARY SYNDROME CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 27768594 Associate
★☆☆☆☆
Found in Text Mining only
Leukemia, Myelocytic, Acute Leukemia GWASCAT_DG 27903959
★☆☆☆☆
Found in Text Mining only
Polycystic Ovary Syndrome Polycystic Ovary Syndrome CTD_human_DG 21411543
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Sclerocystic Ovaries Sclerocystic Ovaries CTD_human_DG 21411543
★☆☆☆☆
Found in Text Mining only