Gene Gene information from NCBI Gene database.
Entrez ID 7739
Gene name Zinc finger protein 185 with LIM domain
Gene symbol ZNF185
Synonyms (NCBI Gene)
SCELL
Chromosome X
Chromosome location Xq28
Summary Zinc-finger proteins bind nucleic acids and play important roles in various cellular functions, including cell proliferation, differentiation, and apoptosis. This gene encodes a LIM-domain zinc finger protein. The LIM domain is composed of two contiguous
miRNA miRNA information provided by mirtarbase database.
181
miRTarBase ID miRNA Experiments Reference
MIRT689983 hsa-miR-4694-3p HITS-CLIP 23313552
MIRT689982 hsa-miR-224-3p HITS-CLIP 23313552
MIRT689981 hsa-miR-522-3p HITS-CLIP 23313552
MIRT689980 hsa-miR-3183 HITS-CLIP 23313552
MIRT689979 hsa-miR-4723-3p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005856 Component Cytoskeleton IEA
GO:0005925 Component Focal adhesion IEA
GO:0008270 Function Zinc ion binding TAS 9268636
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300381 12976 ENSG00000147394
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O15231
Protein name Zinc finger protein 185 (LIM domain protein ZNF185) (P1-A)
Protein function May be involved in the regulation of cellular proliferation and/or differentiation.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in placenta, pancreas and kidney. Also expressed in prostate, testis, ovary and blood.
Sequence
MSISALGGRTKGKPLPPGEEERNNVLKQMKVRTTLKGDKSWITKQDESEGRTIELPSGRS
RATSFSSAGEVPKPRPPSTRAPTGYIIRGVFTKPIDSSSQPQQQFPKANGTPKSAASLVR
TANAGPPRPSSSGYKMTTEDYKKLAPYNIRRSSTSGDTEEEEEEEVVPFSSDEQKRRSEA
ASGVLRRTAPREHSYVLSAAKKSTGPTQETQAPFIAKRVEVVEEDGPSEKSQDPPALARS
TPGSNSADGGRTKASRAIWIECLPSMPSPAGSQELSSRGEEIVRLQILTPRAGLRLVAPD
VEGMRSSPGNKDKEAPCSRELQRDLAGEEAFRAPNTDAARSSAQLSDGNVGSGATGSRPE
GLAAVDIGSERGSSSATSVSAVPADRKSNSTAAQEDAKADPKGALADYEGKDVATRVGEA
WQERPGAPRGGQGDPAVPAQQPADPSTPERQSSPSGSEQLVRRESCGSSVLTDFEGKDVA
TKVGEAWQDRPGAPRGGQGDPAVPTQQPADPSTPEQQNSPSGSEQFVRRESCTSRVRSPS
SCMVTVTVTATSEQPHIYIPAPASELDSSSTTKGILFVKEYVNASEVSSGKPVSARYSNV
SSIEDSFAMEKKPPCGSTPYSERTTGGICTYCNREIRDCPKITLEHLGICCHEYCFKCGI
CSKPMGDLLDQIFIHRDTIHCGKCYEKLF
Sequence length 689
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AUTISTIC DISORDER Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HEARING LOSS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of the head and neck Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 27655485
★☆☆☆☆
Found in Text Mining only
Alport Syndrome Alport Syndrome BEFREE 2654472
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 27768594 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 15731117
★☆☆☆☆
Found in Text Mining only
Carcinoma Pancreatic Ductal Pancreatic ductal carcinoma Pubtator 35111149 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 30337687 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma, Pancreatic Ductal Pancreatic Ductal Carcinoma BEFREE 28927124
★☆☆☆☆
Found in Text Mining only
Degenerative polyarthritis Arthritis BEFREE 30201491
★☆☆☆☆
Found in Text Mining only
Hereditary nephritis Hereditary Nephritis BEFREE 2654472
★☆☆☆☆
Found in Text Mining only
Inborn Errors of Metabolism Inborn Errors Of Metabolism BEFREE 28834604
★☆☆☆☆
Found in Text Mining only