Gene Gene information from NCBI Gene database.
Entrez ID 7730
Gene name Zinc finger protein 177
Gene symbol ZNF177
Synonyms (NCBI Gene)
PIGX
Chromosome 19
Chromosome location 19p13.2
miRNA miRNA information provided by mirtarbase database.
88
miRTarBase ID miRNA Experiments Reference
MIRT708539 hsa-miR-345-3p HITS-CLIP 19536157
MIRT708538 hsa-miR-4732-3p HITS-CLIP 19536157
MIRT708537 hsa-miR-125a-5p HITS-CLIP 19536157
MIRT708536 hsa-miR-125b-5p HITS-CLIP 19536157
MIRT708535 hsa-miR-4319 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II TAS 8661005
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601276 12966 ENSG00000188629
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13360
Protein name Zinc finger protein 177
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 13 54 KRAB box Family
PF13465 zf-H2C2_2 298 323 Domain
PF00096 zf-C2H2 340 362 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 368 390 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 396 418 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 424 446 Zinc finger, C2H2 type Domain
PF13912 zf-C2H2_6 452 477 Domain
Sequence
MAAGWLTTWSQNSVTFQEVAVDFSQEEWALLDPAQKNLYKDVMLENFRNLASVGYQLCRH
SLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQNIPGGKTSNGINTAENQPGEH
SLECNHCGKFRKNTRFICTRYCKGEKCYKYIKYSKVFNHPSTLRSHVSIHIGEKTLEFTD
CRKAFNQESSLRKHLRTPTGQKFQEYEQCDMSFSLHSSCSVREQIPTGEKGDECSDYGKI
SPLSVHTKTGSVEEGLECNEHEKTFTDPLSLQNCVRTHSGEMPYECSDCGKAFIFQSSLK
KHMRSHTGEKPYECDHCGKSFSQ
SSHLNVHKRTHTGEKPYDCKECGKAFTVPSSLQKHVR
TH
TGEKPYECSDCGKAFIDQSSLKKHTRSHTGEKPYECNQCGKSFSTGSYLIVHKRTHTG
EKTYECKECGKAFRNSSCLRVHVRTHTGEKPYKCIQCEKAFSTSTNLIMHKRIHNGQKLH
E
Sequence length 481
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
STOMACH NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Neoplasms Breast neoplasm Pubtator 33499882 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 31547144 Associate
★☆☆☆☆
Found in Text Mining only
Endometrial Carcinoma Endometrial carcinoma BEFREE 26522113
★☆☆☆☆
Found in Text Mining only
Endometrial Neoplasms Endometrial neoplasm Pubtator 26522113 Associate
★☆☆☆☆
Found in Text Mining only
Hereditary Diffuse Gastric Cancer Gastric Cancer CTD_human_DG 16367923
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Lung neoplasms Pubtator 26842235 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of endometrium Endometrial Cancer BEFREE 26522113
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of stomach Stomach Neoplasms CTD_human_DG 16367923
★☆☆☆☆
Found in Text Mining only
Stomach Neoplasms Stomach Neoplasms CTD_human_DG 16367923
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms Stomach neoplasms Pubtator 16367923 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations