Gene Gene information from NCBI Gene database.
Entrez ID 7727
Gene name Zinc finger protein 174
Gene symbol ZNF174
Synonyms (NCBI Gene)
ZSCAN8
Chromosome 16
Chromosome location 16p13.3
Summary This gene encodes a protein with three Cys2-His2-type zinc fingers in the carboxy-terminus, a putative nuclear localization signal, and an amino-terminus SCAN box which forms homodimers. This protein is believed to function as a transcriptional repressor.
miRNA miRNA information provided by mirtarbase database.
82
miRTarBase ID miRNA Experiments Reference
MIRT049596 hsa-miR-92a-3p CLASH 23622248
MIRT037309 hsa-miR-877-5p CLASH 23622248
MIRT695947 hsa-miR-106a-5p HITS-CLIP 23313552
MIRT695946 hsa-miR-106b-5p HITS-CLIP 23313552
MIRT695945 hsa-miR-17-5p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 7673192
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IDA 7673192
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603900 12963 ENSG00000103343
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15697
Protein name Zinc finger protein 174 (AW-1) (Zinc finger and SCAN domain-containing protein 8)
Protein function Transcriptional repressor.
PDB 1Y7Q
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02023 SCAN 42 131 SCAN domain Domain
PF00096 zf-C2H2 326 348 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 354 376 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 382 405 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in a variety of organs, but most strongly in adult testis and ovary followed by small intestine, colon, prostate, thymus, spleen, pancreas, skeletal muscle, heart, brain and kidney. Also expressed in umbilical vein endothelia
Sequence
MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGP
QEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTL
VEDFHRASKKP
KQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQ
AGAYDRLSPHHWEKSPLLQEPTPKLAGTEAPRMRSDNKENPQQEGAKGAKPCAVSAGRSK
GNGLQNPEPRGANMSEPRLSRRQVSSPNAQKPFAHYQRHCRVEYISSPLKSHPLRELKKS
KGGKRSLSNRLQHLGHQPTRSAKKPYKCDDCGKSFTWNSELKRHKRVHTGERPYTCGECG
NCFGRQSTLKLHQRIH
TGEKPYQCGQCGKSFRQSSNLHQHHRLHHGD
Sequence length 407
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
EBV-positive nodal T- and NK-cell lymphoma Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Long QT syndrome Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Ventricular arrhythmia Ventricular arrhythmia BEFREE 29655311
★☆☆☆☆
Found in Text Mining only