Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7726
Gene name	Tripartite motif containing 26
Gene symbol	TRIM26
Synonyms (NCBI Gene)	AFPRNF95ZNF173
Chromosome	6
Chromosome location	6p22.1
Summary	The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Altho

447

Show/Hide all (447)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023586	hsa-miR-1-3p	Proteomics	18668040
MIRT1453587	hsa-miR-1	CLIP-seq
MIRT1453588	hsa-miR-1255a	CLIP-seq
MIRT1453589	hsa-miR-1255b	CLIP-seq
MIRT1453590	hsa-miR-206	CLIP-seq
MIRT1453591	hsa-miR-300	CLIP-seq
MIRT1453592	hsa-miR-3614-5p	CLIP-seq
MIRT1453593	hsa-miR-3664-5p	CLIP-seq
MIRT1453594	hsa-miR-3673	CLIP-seq
MIRT1453595	hsa-miR-381	CLIP-seq
MIRT1453596	hsa-miR-4291	CLIP-seq
MIRT1453597	hsa-miR-4310	CLIP-seq
MIRT1453598	hsa-miR-4317	CLIP-seq
MIRT1453599	hsa-miR-4426	CLIP-seq
MIRT1453600	hsa-miR-4492	CLIP-seq
MIRT1453601	hsa-miR-4498	CLIP-seq
MIRT1453602	hsa-miR-4506	CLIP-seq
MIRT1453603	hsa-miR-4647	CLIP-seq
MIRT1453604	hsa-miR-4659a-5p	CLIP-seq
MIRT1453605	hsa-miR-4659b-5p	CLIP-seq
MIRT1453606	hsa-miR-4662b	CLIP-seq
MIRT1453607	hsa-miR-4714-5p	CLIP-seq
MIRT1453608	hsa-miR-4776-3p	CLIP-seq
MIRT1453609	hsa-miR-4793-3p	CLIP-seq
MIRT1453610	hsa-miR-548a-3p	CLIP-seq
MIRT1453611	hsa-miR-548e	CLIP-seq
MIRT1453612	hsa-miR-548f	CLIP-seq
MIRT1453613	hsa-miR-555	CLIP-seq
MIRT1453614	hsa-miR-580	CLIP-seq
MIRT1453615	hsa-miR-613	CLIP-seq
MIRT1453616	hsa-miR-762	CLIP-seq
MIRT1453617	hsa-miR-890	CLIP-seq
MIRT1453618	hsa-miR-1224-3p	CLIP-seq
MIRT1453619	hsa-miR-1231	CLIP-seq
MIRT1453620	hsa-miR-1243	CLIP-seq
MIRT1453621	hsa-miR-1247	CLIP-seq
MIRT1453622	hsa-miR-1254	CLIP-seq
MIRT1453623	hsa-miR-1260	CLIP-seq
MIRT1453624	hsa-miR-1260b	CLIP-seq
MIRT1453625	hsa-miR-1264	CLIP-seq
MIRT1453626	hsa-miR-1273f	CLIP-seq
MIRT1453627	hsa-miR-1280	CLIP-seq
MIRT1453628	hsa-miR-1289	CLIP-seq
MIRT1453629	hsa-miR-1295	CLIP-seq
MIRT1453630	hsa-miR-1299	CLIP-seq
MIRT1453631	hsa-miR-140-3p	CLIP-seq
MIRT1453632	hsa-miR-143	CLIP-seq
MIRT1453633	hsa-miR-190	CLIP-seq
MIRT1453634	hsa-miR-190b	CLIP-seq
MIRT1453635	hsa-miR-1976	CLIP-seq
MIRT1453591	hsa-miR-300	CLIP-seq
MIRT1453636	hsa-miR-3116	CLIP-seq
MIRT1453637	hsa-miR-3189-3p	CLIP-seq
MIRT1453638	hsa-miR-3201	CLIP-seq
MIRT1453639	hsa-miR-324-5p	CLIP-seq
MIRT1453640	hsa-miR-331-3p	CLIP-seq
MIRT1453641	hsa-miR-335	CLIP-seq
MIRT1453642	hsa-miR-3663-3p	CLIP-seq
MIRT1453593	hsa-miR-3664-5p	CLIP-seq
MIRT1453643	hsa-miR-3667-3p	CLIP-seq
MIRT1453644	hsa-miR-3667-5p	CLIP-seq
MIRT1453645	hsa-miR-3675-5p	CLIP-seq
MIRT1453646	hsa-miR-3682-3p	CLIP-seq
MIRT1453647	hsa-miR-3690	CLIP-seq
MIRT1453648	hsa-miR-370	CLIP-seq
MIRT1453649	hsa-miR-378	CLIP-seq
MIRT1453650	hsa-miR-378b	CLIP-seq
MIRT1453651	hsa-miR-378c	CLIP-seq
MIRT1453652	hsa-miR-378d	CLIP-seq
MIRT1453653	hsa-miR-378e	CLIP-seq
MIRT1453654	hsa-miR-378f	CLIP-seq
MIRT1453655	hsa-miR-378h	CLIP-seq
MIRT1453656	hsa-miR-378i	CLIP-seq
MIRT1453595	hsa-miR-381	CLIP-seq
MIRT1453657	hsa-miR-383	CLIP-seq
MIRT1453658	hsa-miR-3919	CLIP-seq
MIRT1453659	hsa-miR-3942-3p	CLIP-seq
MIRT1453660	hsa-miR-422a	CLIP-seq
MIRT1453661	hsa-miR-4270	CLIP-seq
MIRT1453662	hsa-miR-4297	CLIP-seq
MIRT1453663	hsa-miR-431	CLIP-seq
MIRT1453664	hsa-miR-4320	CLIP-seq
MIRT1453599	hsa-miR-4426	CLIP-seq
MIRT1453665	hsa-miR-4441	CLIP-seq
MIRT1453666	hsa-miR-4446-5p	CLIP-seq
MIRT1453667	hsa-miR-4457	CLIP-seq
MIRT1453668	hsa-miR-4461	CLIP-seq
MIRT1453669	hsa-miR-451b	CLIP-seq
MIRT1453670	hsa-miR-4638-3p	CLIP-seq
MIRT1453671	hsa-miR-4645-5p	CLIP-seq
MIRT1453603	hsa-miR-4647	CLIP-seq
MIRT1453604	hsa-miR-4659a-5p	CLIP-seq
MIRT1453605	hsa-miR-4659b-5p	CLIP-seq
MIRT1453606	hsa-miR-4662b	CLIP-seq
MIRT1453672	hsa-miR-4673	CLIP-seq
MIRT1453673	hsa-miR-4685-5p	CLIP-seq
MIRT1453674	hsa-miR-4690-3p	CLIP-seq
MIRT1453675	hsa-miR-4693-3p	CLIP-seq
MIRT1453676	hsa-miR-4694-5p	CLIP-seq
MIRT1453677	hsa-miR-4708-5p	CLIP-seq
MIRT1453607	hsa-miR-4714-5p	CLIP-seq
MIRT1453678	hsa-miR-4717-5p	CLIP-seq
MIRT1453679	hsa-miR-4755-3p	CLIP-seq
MIRT1453680	hsa-miR-4755-5p	CLIP-seq
MIRT1453681	hsa-miR-4756-3p	CLIP-seq
MIRT1453682	hsa-miR-4757-5p	CLIP-seq
MIRT1453683	hsa-miR-4764-5p	CLIP-seq
MIRT1453684	hsa-miR-4770	CLIP-seq
MIRT1453685	hsa-miR-4772-5p	CLIP-seq
MIRT1453686	hsa-miR-4782-5p	CLIP-seq
MIRT1453687	hsa-miR-4791	CLIP-seq
MIRT1453609	hsa-miR-4793-3p	CLIP-seq
MIRT1453688	hsa-miR-511	CLIP-seq
MIRT1453689	hsa-miR-513b	CLIP-seq
MIRT1453690	hsa-miR-516b	CLIP-seq
MIRT1453691	hsa-miR-518d-5p	CLIP-seq
MIRT1453692	hsa-miR-519b-5p	CLIP-seq
MIRT1453693	hsa-miR-519c-5p	CLIP-seq
MIRT1453694	hsa-miR-520c-5p	CLIP-seq
MIRT1453695	hsa-miR-526a	CLIP-seq
MIRT1453610	hsa-miR-548a-3p	CLIP-seq
MIRT1453611	hsa-miR-548e	CLIP-seq
MIRT1453612	hsa-miR-548f	CLIP-seq
MIRT1453614	hsa-miR-580	CLIP-seq
MIRT1453696	hsa-miR-615-5p	CLIP-seq
MIRT1453697	hsa-miR-654-3p	CLIP-seq
MIRT1453698	hsa-miR-663b	CLIP-seq
MIRT1453699	hsa-miR-711	CLIP-seq
MIRT1453700	hsa-miR-764	CLIP-seq
MIRT1453587	hsa-miR-1	CLIP-seq
MIRT2135993	hsa-miR-1252	CLIP-seq
MIRT1453622	hsa-miR-1254	CLIP-seq
MIRT1453588	hsa-miR-1255a	CLIP-seq
MIRT1453589	hsa-miR-1255b	CLIP-seq
MIRT1453625	hsa-miR-1264	CLIP-seq
MIRT2135994	hsa-miR-1272	CLIP-seq
MIRT2135995	hsa-miR-1276	CLIP-seq
MIRT2135996	hsa-miR-1290	CLIP-seq
MIRT1453630	hsa-miR-1299	CLIP-seq
MIRT2135997	hsa-miR-132	CLIP-seq
MIRT1453631	hsa-miR-140-3p	CLIP-seq
MIRT2135998	hsa-miR-1827	CLIP-seq
MIRT2135999	hsa-miR-1909	CLIP-seq
MIRT1453635	hsa-miR-1976	CLIP-seq
MIRT1453590	hsa-miR-206	CLIP-seq
MIRT2136000	hsa-miR-2110	CLIP-seq
MIRT2136001	hsa-miR-2113	CLIP-seq
MIRT2136002	hsa-miR-212	CLIP-seq
MIRT2136003	hsa-miR-214	CLIP-seq
MIRT1453636	hsa-miR-3116	CLIP-seq
MIRT2136004	hsa-miR-3120-3p	CLIP-seq
MIRT2136005	hsa-miR-3136-5p	CLIP-seq
MIRT2136006	hsa-miR-3150a-3p	CLIP-seq
MIRT2136007	hsa-miR-3152-3p	CLIP-seq
MIRT2136008	hsa-miR-3153	CLIP-seq
MIRT2136009	hsa-miR-3167	CLIP-seq
MIRT2136010	hsa-miR-3175	CLIP-seq
MIRT2136011	hsa-miR-3186-5p	CLIP-seq
MIRT2136012	hsa-miR-3192	CLIP-seq
MIRT1453638	hsa-miR-3201	CLIP-seq
MIRT2136013	hsa-miR-3607-5p	CLIP-seq
MIRT1453592	hsa-miR-3614-5p	CLIP-seq
MIRT2136014	hsa-miR-3619-5p	CLIP-seq
MIRT2136015	hsa-miR-3662	CLIP-seq
MIRT1453642	hsa-miR-3663-3p	CLIP-seq
MIRT1453593	hsa-miR-3664-5p	CLIP-seq
MIRT1453643	hsa-miR-3667-3p	CLIP-seq
MIRT1453644	hsa-miR-3667-5p	CLIP-seq
MIRT1453594	hsa-miR-3673	CLIP-seq
MIRT2136016	hsa-miR-3681	CLIP-seq
MIRT1453646	hsa-miR-3682-3p	CLIP-seq
MIRT2136017	hsa-miR-3689d	CLIP-seq
MIRT1453647	hsa-miR-3690	CLIP-seq
MIRT1453648	hsa-miR-370	CLIP-seq
MIRT1453649	hsa-miR-378	CLIP-seq
MIRT1453650	hsa-miR-378b	CLIP-seq
MIRT1453651	hsa-miR-378c	CLIP-seq
MIRT1453652	hsa-miR-378d	CLIP-seq
MIRT1453653	hsa-miR-378e	CLIP-seq
MIRT1453654	hsa-miR-378f	CLIP-seq
MIRT1453655	hsa-miR-378h	CLIP-seq
MIRT1453656	hsa-miR-378i	CLIP-seq
MIRT2136018	hsa-miR-3908	CLIP-seq
MIRT2136019	hsa-miR-3914	CLIP-seq
MIRT1453658	hsa-miR-3919	CLIP-seq
MIRT1453659	hsa-miR-3942-3p	CLIP-seq
MIRT1453660	hsa-miR-422a	CLIP-seq
MIRT2136020	hsa-miR-4271	CLIP-seq
MIRT1453662	hsa-miR-4297	CLIP-seq
MIRT2136021	hsa-miR-4300	CLIP-seq
MIRT1453663	hsa-miR-431	CLIP-seq
MIRT1453664	hsa-miR-4320	CLIP-seq
MIRT2136022	hsa-miR-4439	CLIP-seq
MIRT1453666	hsa-miR-4446-5p	CLIP-seq
MIRT1453667	hsa-miR-4457	CLIP-seq
MIRT2136023	hsa-miR-4459	CLIP-seq
MIRT1453668	hsa-miR-4461	CLIP-seq
MIRT2136024	hsa-miR-4463	CLIP-seq
MIRT2136025	hsa-miR-4477b	CLIP-seq
MIRT1453600	hsa-miR-4492	CLIP-seq
MIRT1453601	hsa-miR-4498	CLIP-seq
MIRT2136026	hsa-miR-4501	CLIP-seq
MIRT2136027	hsa-miR-4504	CLIP-seq
MIRT2136028	hsa-miR-4505	CLIP-seq
MIRT1453602	hsa-miR-4506	CLIP-seq
MIRT2136029	hsa-miR-4530	CLIP-seq
MIRT2136030	hsa-miR-4534	CLIP-seq
MIRT1453670	hsa-miR-4638-3p	CLIP-seq
MIRT2136031	hsa-miR-4646-5p	CLIP-seq
MIRT2136032	hsa-miR-4649-3p	CLIP-seq
MIRT2136033	hsa-miR-4655-3p	CLIP-seq
MIRT2136034	hsa-miR-4667-5p	CLIP-seq
MIRT2136035	hsa-miR-4668-5p	CLIP-seq
MIRT2136036	hsa-miR-4679	CLIP-seq
MIRT2136037	hsa-miR-4683	CLIP-seq
MIRT1453673	hsa-miR-4685-5p	CLIP-seq
MIRT1453676	hsa-miR-4694-5p	CLIP-seq
MIRT2136038	hsa-miR-4698	CLIP-seq
MIRT2136039	hsa-miR-4700-5p	CLIP-seq
MIRT1453607	hsa-miR-4714-5p	CLIP-seq
MIRT2136040	hsa-miR-4722-5p	CLIP-seq
MIRT2136041	hsa-miR-4725-3p	CLIP-seq
MIRT2136042	hsa-miR-4731-5p	CLIP-seq
MIRT2136043	hsa-miR-4747-5p	CLIP-seq
MIRT1453680	hsa-miR-4755-5p	CLIP-seq
MIRT1453681	hsa-miR-4756-3p	CLIP-seq
MIRT1453682	hsa-miR-4757-5p	CLIP-seq
MIRT1453683	hsa-miR-4764-5p	CLIP-seq
MIRT2136044	hsa-miR-4773	CLIP-seq
MIRT1453686	hsa-miR-4782-5p	CLIP-seq
MIRT1453687	hsa-miR-4791	CLIP-seq
MIRT1453609	hsa-miR-4793-3p	CLIP-seq
MIRT2136045	hsa-miR-4796-3p	CLIP-seq
MIRT2136046	hsa-miR-490-3p	CLIP-seq
MIRT2136047	hsa-miR-490-5p	CLIP-seq
MIRT2136048	hsa-miR-508-5p	CLIP-seq
MIRT1453689	hsa-miR-513b	CLIP-seq
MIRT1453690	hsa-miR-516b	CLIP-seq
MIRT2136049	hsa-miR-520g	CLIP-seq
MIRT2136050	hsa-miR-520h	CLIP-seq
MIRT2136051	hsa-miR-541	CLIP-seq
MIRT2136052	hsa-miR-542-3p	CLIP-seq
MIRT2136053	hsa-miR-545	CLIP-seq
MIRT1453610	hsa-miR-548a-3p	CLIP-seq
MIRT1453611	hsa-miR-548e	CLIP-seq
MIRT1453612	hsa-miR-548f	CLIP-seq
MIRT2136054	hsa-miR-548g	CLIP-seq
MIRT2136055	hsa-miR-548p	CLIP-seq
MIRT1453613	hsa-miR-555	CLIP-seq
MIRT2136056	hsa-miR-581	CLIP-seq
MIRT1453615	hsa-miR-613	CLIP-seq
MIRT2136057	hsa-miR-629	CLIP-seq
MIRT2136058	hsa-miR-634	CLIP-seq
MIRT2136059	hsa-miR-637	CLIP-seq
MIRT2136060	hsa-miR-642a	CLIP-seq
MIRT2136061	hsa-miR-642b	CLIP-seq
MIRT2136062	hsa-miR-654-5p	CLIP-seq
MIRT1453698	hsa-miR-663b	CLIP-seq
MIRT2136063	hsa-miR-671-5p	CLIP-seq
MIRT2136064	hsa-miR-759	CLIP-seq
MIRT2136065	hsa-miR-761	CLIP-seq
MIRT1453616	hsa-miR-762	CLIP-seq
MIRT2136066	hsa-miR-765	CLIP-seq
MIRT2136067	hsa-miR-876-5p	CLIP-seq
MIRT1453617	hsa-miR-890	CLIP-seq
MIRT2136068	hsa-miR-920	CLIP-seq
MIRT2136069	hsa-miR-922	CLIP-seq
MIRT2136070	hsa-miR-936	CLIP-seq
MIRT2136071	hsa-miR-939	CLIP-seq
MIRT2136072	hsa-miR-943	CLIP-seq
MIRT1453625	hsa-miR-1264	CLIP-seq
MIRT2357017	hsa-miR-1285	CLIP-seq
MIRT2135997	hsa-miR-132	CLIP-seq
MIRT2357018	hsa-miR-1323	CLIP-seq
MIRT2136002	hsa-miR-212	CLIP-seq
MIRT2357019	hsa-miR-219-1-3p	CLIP-seq
MIRT2357020	hsa-miR-2467-3p	CLIP-seq
MIRT2357021	hsa-miR-28-5p	CLIP-seq
MIRT2357022	hsa-miR-3064-3p	CLIP-seq
MIRT2357023	hsa-miR-31	CLIP-seq
MIRT2136004	hsa-miR-3120-3p	CLIP-seq
MIRT2357024	hsa-miR-3127-5p	CLIP-seq
MIRT2357025	hsa-miR-3139	CLIP-seq
MIRT2357026	hsa-miR-3170	CLIP-seq
MIRT2357027	hsa-miR-3180-5p	CLIP-seq
MIRT2357028	hsa-miR-3187-5p	CLIP-seq
MIRT2357029	hsa-miR-342-5p	CLIP-seq
MIRT1453642	hsa-miR-3663-3p	CLIP-seq
MIRT1453593	hsa-miR-3664-5p	CLIP-seq
MIRT1453643	hsa-miR-3667-3p	CLIP-seq
MIRT2357030	hsa-miR-3678-3p	CLIP-seq
MIRT1453647	hsa-miR-3690	CLIP-seq
MIRT2136018	hsa-miR-3908	CLIP-seq
MIRT2357031	hsa-miR-4254	CLIP-seq
MIRT2357032	hsa-miR-4259	CLIP-seq
MIRT2357033	hsa-miR-4290	CLIP-seq
MIRT1453663	hsa-miR-431	CLIP-seq
MIRT1453668	hsa-miR-4461	CLIP-seq
MIRT2357034	hsa-miR-4487	CLIP-seq
MIRT1453600	hsa-miR-4492	CLIP-seq
MIRT1453601	hsa-miR-4498	CLIP-seq
MIRT2136028	hsa-miR-4505	CLIP-seq
MIRT2136032	hsa-miR-4649-3p	CLIP-seq
MIRT2357035	hsa-miR-4651	CLIP-seq
MIRT2357036	hsa-miR-4664-5p	CLIP-seq
MIRT2357037	hsa-miR-4682	CLIP-seq
MIRT1453673	hsa-miR-4685-5p	CLIP-seq
MIRT1453675	hsa-miR-4693-3p	CLIP-seq
MIRT1453607	hsa-miR-4714-5p	CLIP-seq
MIRT2357038	hsa-miR-4715-3p	CLIP-seq
MIRT2136044	hsa-miR-4773	CLIP-seq
MIRT2136045	hsa-miR-4796-3p	CLIP-seq
MIRT2357039	hsa-miR-4804-3p	CLIP-seq
MIRT2357040	hsa-miR-520a-5p	CLIP-seq
MIRT2357041	hsa-miR-520d-5p	CLIP-seq
MIRT2136049	hsa-miR-520g	CLIP-seq
MIRT2136050	hsa-miR-520h	CLIP-seq
MIRT2357042	hsa-miR-524-5p	CLIP-seq
MIRT2357043	hsa-miR-525-5p	CLIP-seq
MIRT1453610	hsa-miR-548a-3p	CLIP-seq
MIRT1453611	hsa-miR-548e	CLIP-seq
MIRT1453612	hsa-miR-548f	CLIP-seq
MIRT2357044	hsa-miR-548o	CLIP-seq
MIRT2357045	hsa-miR-571	CLIP-seq
MIRT2357046	hsa-miR-608	CLIP-seq
MIRT2357047	hsa-miR-612	CLIP-seq
MIRT2136061	hsa-miR-642b	CLIP-seq
MIRT2357048	hsa-miR-665	CLIP-seq
MIRT2357049	hsa-miR-708	CLIP-seq
MIRT1453616	hsa-miR-762	CLIP-seq
MIRT2136066	hsa-miR-765	CLIP-seq
MIRT1453648	hsa-miR-370	CLIP-seq
MIRT2136042	hsa-miR-4731-5p	CLIP-seq
MIRT1453587	hsa-miR-1	CLIP-seq
MIRT1453588	hsa-miR-1255a	CLIP-seq
MIRT1453589	hsa-miR-1255b	CLIP-seq
MIRT2135997	hsa-miR-132	CLIP-seq
MIRT2650629	hsa-miR-138	CLIP-seq
MIRT1453635	hsa-miR-1976	CLIP-seq
MIRT1453590	hsa-miR-206	CLIP-seq
MIRT2136002	hsa-miR-212	CLIP-seq
MIRT2136012	hsa-miR-3192	CLIP-seq
MIRT2650630	hsa-miR-323-5p	CLIP-seq
MIRT2650631	hsa-miR-339-5p	CLIP-seq
MIRT1453592	hsa-miR-3614-5p	CLIP-seq
MIRT2650632	hsa-miR-3661	CLIP-seq
MIRT1453643	hsa-miR-3667-3p	CLIP-seq
MIRT1453594	hsa-miR-3673	CLIP-seq
MIRT1453648	hsa-miR-370	CLIP-seq
MIRT2650633	hsa-miR-3921	CLIP-seq
MIRT2650634	hsa-miR-4251	CLIP-seq
MIRT1453662	hsa-miR-4297	CLIP-seq
MIRT2650635	hsa-miR-4329	CLIP-seq
MIRT2650636	hsa-miR-4417	CLIP-seq
MIRT2650637	hsa-miR-4421	CLIP-seq
MIRT1453666	hsa-miR-4446-5p	CLIP-seq
MIRT2650638	hsa-miR-4456	CLIP-seq
MIRT2136024	hsa-miR-4463	CLIP-seq
MIRT2650639	hsa-miR-4474-3p	CLIP-seq
MIRT1453600	hsa-miR-4492	CLIP-seq
MIRT2650640	hsa-miR-4496	CLIP-seq
MIRT1453601	hsa-miR-4498	CLIP-seq
MIRT1453602	hsa-miR-4506	CLIP-seq
MIRT2650641	hsa-miR-4639-3p	CLIP-seq
MIRT2136032	hsa-miR-4649-3p	CLIP-seq
MIRT2650642	hsa-miR-4653-5p	CLIP-seq
MIRT2650643	hsa-miR-4660	CLIP-seq
MIRT2136037	hsa-miR-4683	CLIP-seq
MIRT1453680	hsa-miR-4755-5p	CLIP-seq
MIRT1453682	hsa-miR-4757-5p	CLIP-seq
MIRT2136044	hsa-miR-4773	CLIP-seq
MIRT2136045	hsa-miR-4796-3p	CLIP-seq
MIRT2136046	hsa-miR-490-3p	CLIP-seq
MIRT2136049	hsa-miR-520g	CLIP-seq
MIRT2136050	hsa-miR-520h	CLIP-seq
MIRT2136051	hsa-miR-541	CLIP-seq
MIRT1453610	hsa-miR-548a-3p	CLIP-seq
MIRT1453611	hsa-miR-548e	CLIP-seq
MIRT1453612	hsa-miR-548f	CLIP-seq
MIRT1453613	hsa-miR-555	CLIP-seq
MIRT1453615	hsa-miR-613	CLIP-seq
MIRT2650644	hsa-miR-619	CLIP-seq
MIRT2650645	hsa-miR-631	CLIP-seq
MIRT2136062	hsa-miR-654-5p	CLIP-seq
MIRT1453698	hsa-miR-663b	CLIP-seq
MIRT2650646	hsa-miR-670	CLIP-seq
MIRT1453616	hsa-miR-762	CLIP-seq
MIRT2136066	hsa-miR-765	CLIP-seq
MIRT2650647	hsa-miR-876-3p	CLIP-seq
MIRT1453617	hsa-miR-890	CLIP-seq
MIRT1453587	hsa-miR-1	CLIP-seq
MIRT1453588	hsa-miR-1255a	CLIP-seq
MIRT1453589	hsa-miR-1255b	CLIP-seq
MIRT2135997	hsa-miR-132	CLIP-seq
MIRT2650629	hsa-miR-138	CLIP-seq
MIRT1453635	hsa-miR-1976	CLIP-seq
MIRT1453590	hsa-miR-206	CLIP-seq
MIRT2136002	hsa-miR-212	CLIP-seq
MIRT2136012	hsa-miR-3192	CLIP-seq
MIRT2650630	hsa-miR-323-5p	CLIP-seq
MIRT2650631	hsa-miR-339-5p	CLIP-seq
MIRT1453592	hsa-miR-3614-5p	CLIP-seq
MIRT2650632	hsa-miR-3661	CLIP-seq
MIRT1453643	hsa-miR-3667-3p	CLIP-seq
MIRT1453594	hsa-miR-3673	CLIP-seq
MIRT1453648	hsa-miR-370	CLIP-seq
MIRT2650633	hsa-miR-3921	CLIP-seq
MIRT2650634	hsa-miR-4251	CLIP-seq
MIRT1453662	hsa-miR-4297	CLIP-seq
MIRT2650635	hsa-miR-4329	CLIP-seq
MIRT2650636	hsa-miR-4417	CLIP-seq
MIRT2650637	hsa-miR-4421	CLIP-seq
MIRT1453666	hsa-miR-4446-5p	CLIP-seq
MIRT2650638	hsa-miR-4456	CLIP-seq
MIRT2136024	hsa-miR-4463	CLIP-seq
MIRT2650639	hsa-miR-4474-3p	CLIP-seq
MIRT1453600	hsa-miR-4492	CLIP-seq
MIRT2650640	hsa-miR-4496	CLIP-seq
MIRT1453601	hsa-miR-4498	CLIP-seq
MIRT1453602	hsa-miR-4506	CLIP-seq
MIRT2650641	hsa-miR-4639-3p	CLIP-seq
MIRT2136032	hsa-miR-4649-3p	CLIP-seq
MIRT2650642	hsa-miR-4653-5p	CLIP-seq
MIRT2650643	hsa-miR-4660	CLIP-seq
MIRT2136037	hsa-miR-4683	CLIP-seq
MIRT1453680	hsa-miR-4755-5p	CLIP-seq
MIRT1453682	hsa-miR-4757-5p	CLIP-seq
MIRT2136044	hsa-miR-4773	CLIP-seq
MIRT2136045	hsa-miR-4796-3p	CLIP-seq
MIRT2136046	hsa-miR-490-3p	CLIP-seq
MIRT2136049	hsa-miR-520g	CLIP-seq
MIRT2136050	hsa-miR-520h	CLIP-seq
MIRT2136051	hsa-miR-541	CLIP-seq
MIRT1453610	hsa-miR-548a-3p	CLIP-seq
MIRT1453611	hsa-miR-548e	CLIP-seq
MIRT1453612	hsa-miR-548f	CLIP-seq
MIRT1453613	hsa-miR-555	CLIP-seq
MIRT1453615	hsa-miR-613	CLIP-seq
MIRT2650644	hsa-miR-619	CLIP-seq
MIRT2650645	hsa-miR-631	CLIP-seq
MIRT2136062	hsa-miR-654-5p	CLIP-seq
MIRT1453698	hsa-miR-663b	CLIP-seq
MIRT2650646	hsa-miR-670	CLIP-seq
MIRT1453616	hsa-miR-762	CLIP-seq
MIRT2136066	hsa-miR-765	CLIP-seq
MIRT2650647	hsa-miR-876-3p	CLIP-seq
MIRT1453617	hsa-miR-890	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	21516116, 21750715, 25416956, 32296183
GO:0005634	Component	Nucleus	IDA	25763818
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	34017102
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	19675569
GO:0008270	Function	Zinc ion binding	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	IDA	16260783
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	29203640
GO:0044790	Process	Suppression of viral release by host	IDA	18248090
GO:0045087	Process	Innate immune response	IDA	18248090
GO:0045087	Process	Innate immune response	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12676957, 17884155
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IBA
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IDA	18248090
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	29203640, 34017102
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070979	Process	Protein K11-linked ubiquitination	IDA	34017102
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IDA	34017102

MIM	HGNC	e!Ensembl
600830	12962	ENSG00000234127

Q12899

Protein name

Tripartite motif-containing protein 26 (EC 2.3.2.27) (Acid finger protein) (AFP) (RING finger protein 95) (Zinc finger protein 173)

Protein function

E3 ubiquitin-protein ligase which regulates the IFN-beta production and antiviral response downstream of various DNA-encoded pattern-recognition receptors (PRRs). Also plays a central role in determining the response to different forms of oxidat

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15227	zf-C3HC4_4	16 → 56		Domain
PF00643	zf-B_box	97 → 138	B-box zinc finger	Domain
PF13765	PRY	315 → 363	SPRY-associated domain	Family
PF00622	SPRY	426 → 535	SPRY domain	Family

Sequence

MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTTDVRPISGSRPVCPLCKKPF
KKENIRPVWQLASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLL
CVMCRESREHRPHTAVLMEKAAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALKK
LQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVIS
ELEGKAQQPAAELMQDTRDFLNRYPRKKFWVGKPIARVVKKKTGEFSDKLLSLQRGLREF
QGKLLRDLEYKTVSVTLDPQSASGYLQLSEDWKCVTYTSLYKSAYLHPQQFDCEPGVLGS
KGFTWGKVYWEVEVEREGWSEDEEEGDEEEEGEEEEEEEEAGYGDGYDDWETDEDEESLG
DEEEEEEEEEEEVLESCMVGVARDSVKRKGDLSLRPEDGVWALRLSSSGIWANTSPEAEL
FPALRPRRVGIALDYEGGTVTFTNAESQELIYTFTATFTRRLVPFLWLKWPGTRLLLRP

Sequence length

539

Interactions

View interactions

	Reactome
			Interferon gamma signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIATIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (331)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	12819394, 14645355, 14752227, 22472323, 27351795, 28206673, 28315695, 28617891, 28778497, 28814568, 30196987, 30655835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	7788963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10880763, 18246041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	22073196, 29251405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	14676113, 16785570, 18638391, 18657899, 24708667, 25014222, 30392891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult-onset citrullinemia type 2	Citrullinemia	BEFREE	12424587, 31620407		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha-Fetoprotein Deficiency	Alpha-Fetoprotein Deficiency	ORPHANET_DG	15280901		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha-Fetoprotein Deficiency	Alpha-Fetoprotein Deficiency	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha-Fetoprotein Deficiency	Alpha-Fetoprotein Deficiency	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis Familial	Amyloidosis	Pubtator	6736244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	11983450, 28916194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	28273032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anencephaly	Anencephaly	BEFREE	31700163, 83284		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	15791673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Apraxia oculomotor Cogan type	Apraxia	Pubtator	34193451	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	BEFREE	18350359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22294275		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia	Ataxia	Pubtator	18405395, 29127364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	10464655, 15258781, 1551665, 16380133, 16411093, 17540590, 19535770, 22017321, 23946315, 2579376, 25957637, 2722185, 29127364, 29735117, 30888062, 6597863, 92892, 9521587 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	23946315, 24012110, 26380989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	2491181, 29127364, 32748564	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia with vitamin E deficiency	Friedreich Ataxia	BEFREE	29735117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	GWASDB_DG	23453885		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	GWASCAT_DG	23453885		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29754444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11606506, 27913752, 30624658, 31110209, 31585923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	19785658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	10213924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Polycystic Kidney Disease	Polycystic kidney disease	BEFREE	2453819		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	26986949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Beckwith-Wiedemann Syndrome	Beckwith-Wiedemann Syndrome	LHGDN	17535089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Beckwith-Wiedemann Syndrome	Beckwith-Wiedemann Syndrome	BEFREE	25167201, 28160403, 30646549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	23804593		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	28237490		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	28237490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	27006124	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	34813121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	23453885		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	34696675	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Branchio-Oto-Renal Syndrome	Branchiootorenal Syndrome	BEFREE	6846397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11830647, 8792856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	18497072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24296084	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32748564, 8792856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchospasm	Bronchospasm	BEFREE	22294275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Budd-Chiari Syndrome	Budd-Chiari syndrome	BEFREE	30654065, 31661575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31992114, 37872147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23629442, 28814568, 9619847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	10386812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10842185, 11857021, 12046072, 12378622, 12454776, 12624183, 12679911, 12966430, 1378230, 14716819, 15040024, 15237429, 15300887, 15633217, 15849812 View all (293 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15265907, 15887222, 18425081, 21517136, 23613855, 24018495, 25023358, 26789285, 27006124, 30018179, 32341704, 32476791, 39776121	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30178842, 31578661, 33860126, 36707504	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	GWASCAT_DG	28604730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30946350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	29933751	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35617983, 37919386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19494365, 29933751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia	Cerebellar ataxia	Pubtator	18405395, 23941260	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia	Cerebellar ataxia	Pubtator	34193451	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar atrophy	Cerebellar atrophy	BEFREE	16380133, 18405395, 27644330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar diseases	Pubtator	29356829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	23453885, 28540026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	31036433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Ganglioglioma	Ganglioglioma	BEFREE	7692346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	14676113, 16785570, 18638391, 18657899, 24708667, 25014222, 30392891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	11583969, 20149523, 22431178, 23319432, 27959418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	18407604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	26917546, 31567946	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	28445152, 32841741, 34751187, 39375615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	26888176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis Intrahepatic	Intrahepatic cholestasis	Pubtator	34704407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	24922631, 27862157, 29794869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30413724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	29278878, 30128773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	10655279, 12170085, 12702990, 14633174, 15073122, 19968979, 22820138, 23350952, 23824744, 24425104, 25556449, 26219830, 26782388, 27115761, 27118149 View all (49 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Citrin deficiency	Citrin Deficiency	BEFREE	31620407		★★★★★ ★☆☆☆☆ Found in Text Mining only
CITRULLINEMIA, TYPE II, NEONATAL-ONSET	Citrullinemia	BEFREE	18664871, 23067347, 29137101, 30181955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear cell adenocarcinoma of ovary	Ovarian adenocarcinoma	BEFREE	29933751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	12509286		★★★★★ ★☆☆☆☆ Found in Text Mining only
COENZYME Q10 DEFICIENCY	Coenzyme Q10 Deficiency	BEFREE	29735117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16410824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12297834, 28011514, 30522102, 31191017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23886200, 30522102, 36434637, 36591565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	24465162, 24646840, 26660680, 27677954, 28189396, 28592717, 28951629, 29108923, 29278878, 29290966, 29672637, 31358576, 31672853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	BEFREE	31651872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	2453115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital absence of kidney	Renal agenesis	BEFREE	6846397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital absence of kidneys syndrome	Renal agenesis	BEFREE	6846397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital anomaly of the kidney	Multicystic renal dysplasia	BEFREE	6846397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10951473, 7534926, 7539525, 7542378, 8284287, 8750291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital deficiency in alpha-fetoprotein	Congenital Deficiency In Alpha-Fetoprotein	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	14755412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital exomphalos	Congenital Exomphalos	BEFREE	7681976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hemihypertrophy	Congenital Hemihypertrophy	BEFREE	25167201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital neurologic anomalies	Drachtman Weinblatt Sitarz syndrome	BEFREE	29492593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital omphalocele	Congenital omphalocele	BEFREE	2440304, 7681976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	47393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	31161374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyclical vomiting syndrome (disorder)	Cyclical Vomiting Syndrome	BEFREE	7679544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	31670834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	1709842, 47779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	47779	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Denys-Drash Syndrome	Denys-Drash Syndrome	BEFREE	8844005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermoid Cyst	Dermoid Cyst	BEFREE	30249359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	25457210, 29517696, 29889353, 31490415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19238091, 25457210, 28085178, 29254684, 29517696, 29632425, 29889353, 31490415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30009939, 30260236		★★★★★ ★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	DiGeorge Syndrome	BEFREE	1692182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	10951473, 10969860, 11371107, 11392497, 11762654, 15032969, 15630540, 16390921, 1642274, 16470734, 1700348, 18854864, 20622492, 23744626, 24148422 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	11371107, 11898965, 1379344, 16415966, 18854864, 20622492, 23548233, 2438025, 2456690, 34750768, 35072257, 35948592, 9855608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	36277024	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysgerminoma	Dysgerminoma	BEFREE	28449306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Echogenic Bowel	Echogenic Bowel	BEFREE	12868084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	63552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	31802834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Embolism, Tumor	Embolism	BEFREE	25658620, 26386862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	31769901		★★★★★ ★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	27521507, 31243778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	8766525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31375771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	8766525	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	24833103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Varices	Esophageal varix	BEFREE	28504002, 29994873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	12447956	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	27805304		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	27805304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	25206293, 25852271, 35842345, 35862314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	27380543, 29040988, 29486094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	32341704	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29944670, 31399619, 31655955, 31712073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver, Alcoholic	Alcoholic Fatty Liver	BEFREE	18638391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fetal ascites	Fetal ascites	BEFREE	1709842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	25100136, 25457210, 27123974, 27983762, 28952209, 29315641, 29326488, 29390144, 29500489, 29517696, 30160782, 30417409, 30896550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Finnish congenital nephrotic syndrome	Finnish Congenital Nephrotic Syndrome	BEFREE	11241530, 12047969, 27004616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	8543634	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	7692346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	14666679, 14752227, 22472323, 31146977, 31490893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	30905450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	29381084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	31599689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroschisis	Gastroschisis	BEFREE	7681976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	10202131, 10866307, 12860944, 28967388, 29933751, 30367785, 30985686, 31355926, 31836006, 7535510, 9681083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	32341704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37872147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis, Membranoproliferative	Glomerulonephritis	BEFREE	3464374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	10213924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	32174066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	28273032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
HEMIHYPERPLASIA, ISOLATED	Hemihyperplasia	BEFREE	25167201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	28403980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Vein Thrombosis	Hepatic Vein Thrombosis	BEFREE	30654065, 31661575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	17465484, 27835879	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	24187458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22155556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	32341704	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	10361518, 19293036, 22681639, 25914481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	31383828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	10202131, 11568928, 1377019, 15221005, 19437037, 21448630, 25167201, 26516161, 27933740, 28160403, 28232059, 28378832, 28806258, 28851352, 29744604 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	15274079	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	2432915, 28160403, 28851352, 33368532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	29424599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	23382965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	22901228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary persistence of alpha-fetoprotein	Hereditary Persistence Of Alpha-Fetoprotein	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
HHH syndrome	Hyperornithinemia-hyperammonemia-homocitrullinuria syndrome	BEFREE	31260111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole, Partial	Hydatidiform Mole	BEFREE	2473468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	Pubtator	25557780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	7241527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrops Fetalis, Non-Immune	Hydrops Fetalis	BEFREE	3893126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	30280963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	15258781, 31182267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	BEFREE	30816533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27380543, 28395283, 31110209, 31490415		★★★★★ ★☆☆☆☆ Found in Text Mining only
HYPERTRICHOSIS, CONGENITAL GENERALIZED	HYPERTRICHOSIS	BEFREE	28866371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	31110209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	BEFREE	28448999, 29356829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypobetalipoproteinemias	Hypoalphalipoproteinemia	Pubtator	35842345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	31152694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23830978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	BEFREE	29671115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30624658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	20149523, 21423153, 27301956, 30325540, 30462849, 30876788, 31179237, 31567946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Neuronal Ceroid Lipofuscinosis	Neuronal Ceroid Lipofuscinosis	BEFREE	31585923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	21147844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30413724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal cleft	Laryngeal cleft	BEFREE	30661942, 9328326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	16489442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10078960, 10190313, 10202131, 10202132, 10223233, 10397245, 10428217, 10453948, 10476206, 10580126, 10668884, 10673071, 10680884, 10728807, 10760695 View all (941 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	14714299, 15040024, 15265907, 15305374, 17175353, 17175354, 17237442, 18316609, 18354237, 18407604, 18466288, 18479159, 18551609, 18563566, 19003875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	15276417, 24012840, 28284560, 9029167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	10655279, 12170085, 12702990, 12759542, 14633174, 15073122, 15305374, 15492142, 15993394, 18553011, 19968979, 21526984, 22625427, 22820138, 23319432 View all (92 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	18165175, 20532728, 29517696, 31992114, 32341704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	24349054	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	23935864, 31383828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	28407756	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	18647234, 29300103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	26884856, 30361144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10202131, 10223233, 10476206, 10580126, 11819788, 14508391, 14666679, 15888795, 16618420, 1694000, 17063518, 1719374, 17595778, 18479159, 18485897 View all (39 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	17465484, 18194454, 19038010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33607799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23139605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34751187	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15849812, 2466459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	30628989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	23453885		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Carcinoid Syndrome	Carcinoid tumor of intestine	BEFREE	10102525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11830647, 8792856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	18497072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	28011514, 31191017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	28471540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	10202131, 11401492, 11911966, 14676113, 16785570, 1707028, 17465484, 18194454, 18638391, 18657899, 19038010, 21216289, 21389603, 21621154, 21835849 View all (48 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19494365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23319432, 28011514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29211355, 9879288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11314020, 14645355, 14666679, 14745610, 17671116, 22472323, 23319432, 23382965, 23787496, 26986949, 28423604, 28545511, 28693208, 28928842, 29174919 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	23382965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	10465338, 29262668, 31652641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11165141, 11314020, 12503217, 15908320, 16166448, 16410824, 17075974, 18997814, 19038010, 20149523, 21388746, 21835849, 22321574, 22472323, 22872641 View all (48 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	10465338, 28612337, 29262668, 31597402, 31652641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16410824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	18497072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	18497072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	18497072		★★★★★ ★☆☆☆☆ Found in Text Mining only
McCune-Albright Syndrome	McCune-Albright Syndrome	BEFREE	30628989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meckel syndrome type 1	Meckel Syndrome	BEFREE	17389183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meconium ileus	Meconium ileus	BEFREE	1709842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mediastinal Germ Cell Tumor	Mediastinal Tumor	BEFREE	28407756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	25206293	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30172994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	29505494, 38049860	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	29935643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	25122203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30641832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29956500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	29956500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10190313, 10202131, 10566736, 10668884, 10790217, 10805758, 10810614, 10811491, 10866307, 10880763, 10915729, 10998444, 11165141, 11289138, 11354284 View all (415 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms, Germ Cell and Embryonal	Neoplasm	LHGDN	18802946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	23389381, 30905450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	25557780, 9067923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis, congenital	Nephrosis, Congenital	BEFREE	12047969, 25155730, 48616, 6851264, 9067923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	11898965, 4600902, 47393	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	17364279, 26806611, 35072257, 63552, 86382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	2428249, 2430743, 2438935, 2473468, 30170416, 47393, 6205588, 7241527, 8284287, 84722, 9681083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	LHGDN	18577995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	23941260, 24120489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	28273032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	2722185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27634970, 29773419, 31828503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	31655955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nongerminomatous Germ Cell Tumor	Nongerminomatous Tumor	BEFREE	14582602, 27855672, 31163007		★★★★★ ★☆☆☆☆ Found in Text Mining only
NUT midline carcinoma	Carcinoma	BEFREE	26402248, 27855672, 28407756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31828503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal Syndrome	BEFREE	7516514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	31693242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculomotor apraxia	Oculomotor apraxia	BEFREE	15732101, 18625865, 20869730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculovestibuloauditory syndrome	Oculovestibuloauditory Syndrome	BEFREE	15732101, 18625865, 20869730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	37591850	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	19494365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	31399054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	1376179, 29933751	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23319432, 28011514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16033080, 27425386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30927273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelizaeus-Merzbacher Disease	Pelizaeus-Merzbacher disease	BEFREE	15791673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	31152694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral motor neuropathy	Motor nerve neuritis	BEFREE	18663494, 19893583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	15258781, 16717225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	15258781, 16717225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pfaundler-Hurler Syndrome	Pfaundler-Hurler Syndrome	BEFREE	53444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	37605237	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyneuropathies	Polyneuropathy	Pubtator	29356829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Porphyria, Erythropoietic	Congenital erythropoietic porphyria	BEFREE	15065102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	30473220, 30886700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Vein Thrombosis	Portal Vein Thrombosis	BEFREE	28208001, 28862714, 29066120, 30246323, 30425509, 31418936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	30325540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive cerebellar ataxia	Cerebellar Ataxia	BEFREE	26628246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Propionic acidemia	Propionic acidemia	BEFREE	29433791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29211355, 9879288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	29211355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	17444854, 19238091, 19293036, 22431178, 27271989, 31655955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyloric Atresia	Pyloric Atresia	BEFREE	10701857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	31661575		★★★★★ ★☆☆☆☆ Found in Text Mining only
RENAL ADYSPLASIA	Renal Aplasia	BEFREE	6846397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	28471540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal tubular disorder	Renal Tubular Disorder	BEFREE	7516514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	22294275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	22294275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	29784390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	17804836, 19503088		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	27913752, 31661575		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sacrococcygeal teratoma	Sacrococcygeal teratoma	BEFREE	30249359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	35862314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	21926974, 22883433, 23453885, 28540026, 30285260		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASDB_DG	21926974, 22883433, 23637625		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seminoma	Seminoma	Pubtator	10386812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	14582602, 2423223, 24922631, 28668957, 30875280, 7524297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorimotor neuropathy	Sensorimotor neuropathy	BEFREE	23941260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31110209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sertoli-Leydig Cell Tumor	Sertoli-Leydig Cell Tumor	BEFREE	28582340, 30334998		★★★★★ ★☆☆☆☆ Found in Text Mining only
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	7520583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	16378325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	9276026	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	2438285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	26178427, 28453864, 6186144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida, Open	Spina Bifida	BEFREE	31700163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar ataxia autosomal recessive 1	Spinocerebellar ataxia	Pubtator	18405395, 19744353, 27644330	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Autosomal Recessive 8	Spinocerebellar ataxia	Pubtator	21394101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA, AUTOSOMAL RECESSIVE 1	Spinocerebellar Ataxia	BEFREE	19569000, 29127364		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPONDYLOCARPOTARSAL SYNOSTOSIS SYNDROME	Spondylocarpotarsal Synostosis Syndrome	BEFREE	30249359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	GWASCAT_DG	28604730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	18397226, 19238091, 27380543, 29040988, 29486094, 30260236, 30904888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11314020, 14645355, 14666679, 14745610, 22472323, 23319432, 23382965, 23787496, 26986949, 28273032, 28423604, 28545511, 28693208, 28928842, 29174919 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	1376179, 14645355, 14978340, 15897638, 19243386, 23382965, 27057629, 28273032, 31915699, 34706681, 35432838, 36076263, 37017469, 37974386, 8766525	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	23382965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	30030856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Superior Vena Cava Syndrome	Superior Vena Cava Syndrome	BEFREE	28407756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	11745252, 19785009, 29262668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	2423223, 25550541, 30321995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	30321995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	10386812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	15300887	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	23988857	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	27913752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	30641832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	10951473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tyrosinemia, Type I	Tyrosinemia	BEFREE	28755188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tyrosinemias	Tyrosinemia	Pubtator	1401056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
UV-Sensitive Syndrome	UV-Sensitive Syndrome	BEFREE	12509286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	30587620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin K Deficiency	Vitamin k deficiency	Pubtator	31693242, 33849479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	GWASDB_DG	20526339		★★★★★ ★☆☆☆☆ Found in Text Mining only

TRIM26 (tripartite motif containing 26)