Gene Gene information from NCBI Gene database.
Entrez ID 7718
Gene name Zinc finger protein 165
Gene symbol ZNF165
Synonyms (NCBI Gene)
CT53LD65ZSCAN7
Chromosome 6
Chromosome location 6p22.1
Summary This gene encodes a member of the Kruppel family of zinc finger proteins. Members of this DNA-binding protein family act as transcriptional regulators. This gene is located within a cluster of zinc finger family members. The encoded protein may play a rol
miRNA miRNA information provided by mirtarbase database.
5
miRTarBase ID miRNA Experiments Reference
MIRT024922 hsa-miR-215-5p Microarray 19074876
MIRT026191 hsa-miR-192-5p Microarray 19074876
MIRT1517032 hsa-miR-1238 CLIP-seq
MIRT1517033 hsa-miR-4310 CLIP-seq
MIRT1517034 hsa-miR-4699-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 16189514, 25910212, 31515488, 32296183, 32814053
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600834 12953 ENSG00000197279
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P49910
Protein name Zinc finger protein 165 (Cancer/testis antigen 53) (CT53) (LD65) (Zinc finger and SCAN domain-containing protein 7)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02023 SCAN 45 134 SCAN domain Domain
PF00096 zf-C2H2 344 366 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 372 394 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 400 422 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 428 450 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 456 478 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed specifically in testis.
Sequence
MATEPKKAAAQNSPEDEGLLIVKIEEEEFIHGQDTCLQRSELLKQELCRQLFRQFCYQDS
PGPREALSRLRELCCQWLKPEIHTKEQILELLVLEQFLTILPGDLQAWVHEHYPESGEEA
VTILEDLERGTDEA
VLQVQAHEHGQEIFQKKVSPPGPALNVKLQPVETKAHFDSSEPQLL
WDCDNESENSRSMPKLEIFEKIESQRIISGRISGYISEASGESQDICKSAGRVKRQWEKE
SGESQRLSSAQDEGFGKILTHKNTVRGEIISHDGCERRLNLNSNEFTHQKSCKHGTCDQS
FKWNSDFINHQIIYAGEKNHQYGKSFKSPKLAKHAAVFSGDKTHQCNECGKAFRHSSKLA
RHQRIH
TGERCYECNECGKSFAESSDLTRHRRIHTGERPFGCKECGRAFNLNSHLIRHQR
IH
TREKPYECSECGKTFRVSSHLIRHFRIHTGEKPYECSECGRAFSQSSNLSQHQRIHMR
ENLLM
Sequence length 485
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
PARKINSON DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Benign Prostatic Hyperplasia Benign Prostatic Hyperplasia BEFREE 25214475
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 15354214, 35692498 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of bladder Bladder carcinoma BEFREE 25214475
★☆☆☆☆
Found in Text Mining only
Carcinoma Transitional Cell Transitional cell carcinoma Pubtator 25214475 Associate
★☆☆☆☆
Found in Text Mining only
Coronary heart disease Coronary Heart Disease GWASDB_DG 21971053
★☆☆☆☆
Found in Text Mining only
Hemochromatosis Hemochromatosis Pubtator 18990219 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of urinary bladder Urinary bladder cancer BEFREE 25214475
★☆☆☆☆
Found in Text Mining only
Parkinson Disease Parkinson disease GWASCAT_DG 28892059
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive Chronic obstructive pulmonary disease Pubtator 22621770 Associate
★☆☆☆☆
Found in Text Mining only
Stomach Neoplasms Stomach neoplasms Pubtator 35974335 Associate
★☆☆☆☆
Found in Text Mining only