Gene Gene information from NCBI Gene database.
Entrez ID 7712
Gene name Zinc finger protein 157
Gene symbol ZNF157
Synonyms (NCBI Gene)
HZF22
Chromosome X
Chromosome location Xp11.3
Summary This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic
miRNA miRNA information provided by mirtarbase database.
1
miRTarBase ID miRNA Experiments Reference
MIRT017547 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IEA
GO:0006355 Process Regulation of DNA-templated transcription IEA
GO:0008270 Function Zinc ion binding IEA
GO:0046872 Function Metal ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300024 12942 ENSG00000147117
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P51786
Protein name Zinc finger protein 157 (Zinc finger protein HZF22)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 26 67 KRAB box Family
PF00096 zf-C2H2 162 184 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 190 212 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 218 240 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 246 268 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 274 296 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 302 324 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 330 352 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 358 380 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 414 436 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 470 492 Zinc finger, C2H2 type Domain
Sequence
MPANGTSPQRFPALIPGEPGRSFEGSVSFEDVAVDFTRQEWHRLDPAQRTMHKDVMLETY
SNLASVG
LCVAKPEMIFKLERGEELWILEEESSGHGYSGSLSLLCGNGSVGDNALRHDND
LLHHQKIQTLDQNVEYNGCRKAFHEKTGFVRRKRTPRGDKNFECHECGKAYCRKSNLVEH
LRIH
TGERPYECGECAKTFSARSYLIAHQKTHTGERPFECNECGKSFGRKSQLILHTRTH
TGERPYECTECGKTFSEKATLTIHQRTHTGEKPYECSECGKTFRVKISLTQHHRTHTGEK
PYECGECGKNFRAKKSLNQHQRIHTGEKPYECGECGKFFRMKMTLNNHQRTHTGEKPYQC
NECGKSFRVHSSLGIHQRIH
TGEKPYECNECGNAFYVKARLIEHQRMHSGEKPYECSECG
KIFSMKKSLCQHRRTH
TGEKPYECSECGNAFYVKVRLIEHQRIHTGERPFECQECGKAFC
RKAHLTEHQRTH
IGWSWRCTMKKASH
Sequence length 506
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
GOUT GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Glycosuria Renal Renal glycosuria Pubtator 34338422 Associate
★☆☆☆☆
Found in Text Mining only
Medulloblastoma Medulloblastoma Pubtator 18664619 Associate
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 18664619
★☆☆☆☆
Found in Text Mining only
VACTERL association Vacterl association Pubtator 34338422 Associate
★☆☆☆☆
Found in Text Mining only