Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	765
Gene name	Carbonic anhydrase 6
Gene symbol	CA6
Synonyms (NCBI Gene)	CA-VIGUSTIN
Chromosome	1
Chromosome location	1p36.23
Summary	The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknow

Show/Hide all (56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT682749	hsa-miR-4797-5p	HITS-CLIP	23706177
MIRT682748	hsa-miR-217	HITS-CLIP	23706177
MIRT682747	hsa-miR-6807-3p	HITS-CLIP	23706177
MIRT682746	hsa-miR-5586-3p	HITS-CLIP	23706177
MIRT682745	hsa-miR-759	HITS-CLIP	23706177
MIRT682744	hsa-miR-6849-3p	HITS-CLIP	23706177
MIRT682743	hsa-miR-6742-3p	HITS-CLIP	23706177
MIRT682742	hsa-miR-20a-3p	HITS-CLIP	23706177
MIRT682741	hsa-miR-6776-5p	HITS-CLIP	23706177
MIRT682740	hsa-miR-873-3p	HITS-CLIP	23706177
MIRT682739	hsa-miR-661	HITS-CLIP	23706177
MIRT682738	hsa-miR-542-3p	HITS-CLIP	23706177
MIRT682737	hsa-miR-6512-3p	HITS-CLIP	23706177
MIRT682736	hsa-miR-6720-5p	HITS-CLIP	23706177
MIRT682735	hsa-miR-3672	HITS-CLIP	23706177
MIRT682734	hsa-miR-6864-3p	HITS-CLIP	23706177
MIRT682733	hsa-miR-1262	HITS-CLIP	23706177
MIRT682732	hsa-miR-4701-3p	HITS-CLIP	23706177
MIRT682731	hsa-miR-6736-5p	HITS-CLIP	23706177
MIRT452598	hsa-miR-3614-5p	PAR-CLIP	23592263
MIRT452597	hsa-miR-6500-3p	PAR-CLIP	23592263
MIRT452595	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT452596	hsa-miR-4459	PAR-CLIP	23592263
MIRT452594	hsa-miR-4433a-3p	PAR-CLIP	23592263
MIRT452593	hsa-miR-1972	PAR-CLIP	23592263
MIRT452592	hsa-miR-4786-5p	PAR-CLIP	23592263
MIRT452590	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT452591	hsa-miR-593-5p	PAR-CLIP	23592263
MIRT682749	hsa-miR-4797-5p	HITS-CLIP	23706177
MIRT682748	hsa-miR-217	HITS-CLIP	23706177
MIRT682747	hsa-miR-6807-3p	HITS-CLIP	23706177
MIRT682746	hsa-miR-5586-3p	HITS-CLIP	23706177
MIRT682745	hsa-miR-759	HITS-CLIP	23706177
MIRT682744	hsa-miR-6849-3p	HITS-CLIP	23706177
MIRT682743	hsa-miR-6742-3p	HITS-CLIP	23706177
MIRT682742	hsa-miR-20a-3p	HITS-CLIP	23706177
MIRT682741	hsa-miR-6776-5p	HITS-CLIP	23706177
MIRT682740	hsa-miR-873-3p	HITS-CLIP	23706177
MIRT682739	hsa-miR-661	HITS-CLIP	23706177
MIRT682738	hsa-miR-542-3p	HITS-CLIP	23706177
MIRT682737	hsa-miR-6512-3p	HITS-CLIP	23706177
MIRT682736	hsa-miR-6720-5p	HITS-CLIP	23706177
MIRT682735	hsa-miR-3672	HITS-CLIP	23706177
MIRT682734	hsa-miR-6864-3p	HITS-CLIP	23706177
MIRT682733	hsa-miR-1262	HITS-CLIP	23706177
MIRT682732	hsa-miR-4701-3p	HITS-CLIP	23706177
MIRT682731	hsa-miR-6736-5p	HITS-CLIP	23706177
MIRT452598	hsa-miR-3614-5p	PAR-CLIP	23592263
MIRT452597	hsa-miR-6500-3p	PAR-CLIP	23592263
MIRT452595	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT452596	hsa-miR-4459	PAR-CLIP	23592263
MIRT452594	hsa-miR-4433a-3p	PAR-CLIP	23592263
MIRT452593	hsa-miR-1972	PAR-CLIP	23592263
MIRT452592	hsa-miR-4786-5p	PAR-CLIP	23592263
MIRT452590	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT452591	hsa-miR-593-5p	PAR-CLIP	23592263

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IDA	24248522
GO:0004089	Function	Carbonate dehydratase activity	IBA
GO:0004089	Function	Carbonate dehydratase activity	IEA
GO:0004089	Function	Carbonate dehydratase activity	TAS	2433278
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	24248522
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708

MIM	HGNC	e!Ensembl
114780	1380	ENSG00000131686

P23280

Protein name

Carbonic anhydrase 6 (EC 4.2.1.1) (Carbonate dehydratase VI) (Carbonic anhydrase VI) (CA-VI) (Salivary carbonic anhydrase) (Secreted carbonic anhydrase)

Protein function

Reversible hydration of carbon dioxide. Its role in saliva is unknown.

PDB

3FE4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00194	Carb_anhydrase	22 → 277	Eukaryotic-type carbonic anhydrase	Domain

Tissue specificity

TISSUE SPECIFICITY: Major constituent of saliva.

Sequence

MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYN
PSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSE
ISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNF
ISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLS
RTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEIL
DYLRRALN

Sequence length

308

Interactions

View interactions

	KEGG		Reactome
	Nitrogen metabolism Metabolic pathways		Reversible hydration of carbon dioxide

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30161055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33104454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28423504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28423504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	26125798, 30679524, 31481705	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	29504954, 30161055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	11167772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	11167772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	6370286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	26398767	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33456371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	31481705	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CA6 (carbonic anhydrase 6)