Gene Gene information from NCBI Gene database.
Entrez ID 7634
Gene name Zinc finger protein 80
Gene symbol ZNF80
Synonyms (NCBI Gene)
pT17
Chromosome 3
Chromosome location 3q13.31
miRNA miRNA information provided by mirtarbase database.
27
miRTarBase ID miRNA Experiments Reference
MIRT045243 hsa-miR-186-5p CLASH 23622248
MIRT643117 hsa-miR-4719 HITS-CLIP 23824327
MIRT643117 hsa-miR-4719 HITS-CLIP 23824327
MIRT1540356 hsa-miR-1183 CLIP-seq
MIRT1540357 hsa-miR-200b CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
194553 13155 ENSG00000174255
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P51504
Protein name Zinc finger protein 80 (ZNFpT17)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 49 71 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 133 155 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 161 183 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 217 239 Zinc finger, C2H2 type Domain
Sequence
MSPKRDGLGTGDGLHSQVLQEQVSTGDNLHECDSQGPSKDTLVREGKTYKCKECGSVFNK
NSLLVRHQQIH
TGVKPYECQECGKAFPEKVDFVRPMRIHTGEKPCKCVECGKVFNRRSHL
LCYRQIHTGEKPYECSECGKTFSYHSVFIQHRVTHTGEKLFGCKECGKTFYYNSSLTRHM
KIH
TGEKPCKCSECGKTFTYRSVFFRHSMTHTAGKPYECKECGKGFYYSYSLTRHTRSHT
GEKPYECLEHRKDFGYHSAFAQQSKIHSGGKNL
Sequence length 273
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
MAJOR DEPRESSIVE DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Cardiomyopathy Hypertrophic Hypertrophic cardiomyopathy Pubtator 27688314 Associate
★☆☆☆☆
Found in Text Mining only
Depressive disorder Mental Depression BEFREE 21630437
★☆☆☆☆
Found in Text Mining only
Hypertrophic Cardiomyopathy Hypertrophic cardiomyopathy BEFREE 27688314
★☆☆☆☆
Found in Text Mining only
Mental Depression Mental Depression BEFREE 21630437
★☆☆☆☆
Found in Text Mining only