Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7592
Gene name	Zinc finger protein 41
Gene symbol	ZNF41
Synonyms (NCBI Gene)	MRX89
Chromosome	X
Chromosome location	Xp11.3
Summary	This gene encodes a protein that contains KRAB-A and KRAB-B domains multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. An initial study suggested that this gene may be associated with X-linked cognitiv

Show/Hide all (35)

miRTarBase ID	miRNA	Experiments	Reference
MIRT439204	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439204	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1524013	hsa-miR-25	CLIP-seq
MIRT1524014	hsa-miR-32	CLIP-seq
MIRT1524015	hsa-miR-363	CLIP-seq
MIRT1524016	hsa-miR-367	CLIP-seq
MIRT1524017	hsa-miR-4325	CLIP-seq
MIRT1524018	hsa-miR-548c-3p	CLIP-seq
MIRT1524019	hsa-miR-92a	CLIP-seq
MIRT1524020	hsa-miR-92b	CLIP-seq
MIRT1524021	hsa-miR-1224-5p	CLIP-seq
MIRT1524022	hsa-miR-153	CLIP-seq
MIRT1524023	hsa-miR-2964a-3p	CLIP-seq
MIRT1524024	hsa-miR-337-3p	CLIP-seq
MIRT1524025	hsa-miR-448	CLIP-seq
MIRT1524026	hsa-miR-4668-5p	CLIP-seq
MIRT1524027	hsa-miR-4751	CLIP-seq
MIRT1524028	hsa-miR-4789-5p	CLIP-seq
MIRT1524029	hsa-miR-586	CLIP-seq
MIRT1524030	hsa-miR-617	CLIP-seq
MIRT2158386	hsa-miR-145	CLIP-seq
MIRT2377850	hsa-miR-1252	CLIP-seq
MIRT2377851	hsa-miR-1269	CLIP-seq
MIRT2377852	hsa-miR-1269b	CLIP-seq
MIRT2377853	hsa-miR-1288	CLIP-seq
MIRT2158386	hsa-miR-145	CLIP-seq
MIRT2377854	hsa-miR-1825	CLIP-seq
MIRT2377855	hsa-miR-199a-5p	CLIP-seq
MIRT2377856	hsa-miR-199b-5p	CLIP-seq
MIRT2377857	hsa-miR-3124-3p	CLIP-seq
MIRT2377858	hsa-miR-3180-5p	CLIP-seq
MIRT2377859	hsa-miR-4515	CLIP-seq
MIRT2377860	hsa-miR-4740-5p	CLIP-seq
MIRT2377861	hsa-miR-511	CLIP-seq
MIRT2377858	hsa-miR-3180-5p	CLIP-seq

Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 25910212, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
314995	13107	ENSG00000147124

P51814

Protein name

Zinc finger protein 41

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01352	KRAB	68 → 109	KRAB box	Family
PF00096	zf-C2H2	313 → 335	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	369 → 391	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	397 → 419	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	425 → 447	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	453 → 475	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	481 → 503	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	509 → 531	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	537 → 559	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	565 → 587	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	593 → 615	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	621 → 643	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	649 → 671	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	677 → 699	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	706 → 727	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	733 → 755	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	761 → 783	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	789 → 811	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:14628291}.

Sequence

MAANGDSPPWSPALAAEGRGSSCEVRRERTPEARIHSVKRYPDLSPGPKGRSSADHAALN
SIVSLQASVSFEDVTVDFSKEEWQHLDPAQRRLYWDVTLENYSHLLSVGYQIPKSEAAFK
LEQGEGPWMLEGEAPHQSCSGEAIGKMQQQGIPGGIFFHCERFDQPIGEDSLCSILEELW
QDNDQLEQRQENQNNLLSHVKVLIKERGYEHKNIEKIIHVTTKLVPSIKRLHNCDTILKH
TLNSHNHNRNSATKNLGKIFGNGNNFPHSPSSTKNENAKTGANSCEHDHYEKHLSHKQAP
THHQKIHPEEKLYVCTECVMGFTQKSHLFEHQRIHAGEKSRECDKSNKVFPQKPQVDVHP
SVYTGEKPYLCTQCGKVFTLKSNLITHQKIHTGQKPYKCSECGKAFFQRSDLFRHLRIHT
GEKPYECSECGKGFSQNSDLSIHQKTHTGEKHYECNECGKAFTRKSALRMHQRIHTGEKP
YVCADCGKAFIQKSHFNTHQRIHTGEKPYECSDCGKSFTKKSQLHVHQRIHTGEKPYICT
ECGKVFTHRTNLTTHQKTHTGEKPYMCAECGKAFTDQSNLIKHQKTHTGEKPYKCNGCGK
AFIWKSRLKIHQKSHIGERHYECKDCGKAFIQKSTLSVHQRIHTGEKPYVCPECGKAFIQ
KSHFIAHHRIHTGEKPYECSDCGKCFTKKSQLRVHQKIHTGEKPNICAECGKAFTDRSNL
ITHQKIHTREKPYECGDCGKTFTWKSRLNIHQKSHTGERHYECSKCGKAFIQKATLSMHQ
IIHTGKKPYACTECQKAFTDRSNLIKHQKMHSGEKRYKASD

Sequence length

821

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Abnormality of neuronal migration	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	-	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITION DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	-	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Global developmental delay	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
History of neurodevelopmental disorder	Benign; Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual disability	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MENTAL RETARDATION, X-LINKED NONSYNDROMIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-syndromic X-linked intellectual disability	Uncertain significance	ClinVar ClinGen	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Seizure	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	-	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
X-LINKED INTELLECTUAL DISABILITY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ZNF41-related disorder	Benign; Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (26)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
2-3 toe syndactyly	Syndactyly Of The Toes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	CTD_human_DG	14628291		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognition disorder	Pubtator	14628291	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Facial paralysis	Facial paralysis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Intellectual Disability	Mental retardation	BEFREE	14628291		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Intellectual Disability	Intellectual developmental disorder	Pubtator	14628291, 23871722	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Macrocephaly	Macrocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Meckel Diverticulum	Meckel Diverticulum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	14628291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	14628291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked	Mental retardation	BEFREE	14628291, 16385466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked	Mental retardation	CTD_human_DG	14628291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked	Mental retardation	GENOMICS_ENGLAND_DG	23871722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked 1	Mental Retardation, X-Linked	BEFREE	14628291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked 1	Mental Retardation, X-Linked	ORPHANET_DG	23871722		★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED 89	Mental retardation	GENOMICS_ENGLAND_DG	23871722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild neurosensory hearing impairment	Neurosensory Hearing impairment	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Moderate intellectual disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	14628291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
X-linked non-syndromic intellectual disability	Non-Syndromic Intellectual Disability, X-Linked	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF41 (zinc finger protein 41)