Gene Gene information from NCBI Gene database.
Entrez ID 7592
Gene name Zinc finger protein 41
Gene symbol ZNF41
Synonyms (NCBI Gene)
MRX89
Chromosome X
Chromosome location Xp11.3
Summary This gene encodes a protein that contains KRAB-A and KRAB-B domains multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. An initial study suggested that this gene may be associated with X-linked cognitiv
miRNA miRNA information provided by mirtarbase database.
35
miRTarBase ID miRNA Experiments Reference
MIRT439204 hsa-miR-218-5p HITS-CLIP 23212916
MIRT439204 hsa-miR-218-5p HITS-CLIP 23212916
MIRT1524013 hsa-miR-25 CLIP-seq
MIRT1524014 hsa-miR-32 CLIP-seq
MIRT1524015 hsa-miR-363 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 25416956, 25910212, 32296183
GO:0005634 Component Nucleus IEA
GO:0006355 Process Regulation of DNA-templated transcription IEA
GO:0008270 Function Zinc ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
314995 13107 ENSG00000147124
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P51814
Protein name Zinc finger protein 41
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 68 109 KRAB box Family
PF00096 zf-C2H2 313 335 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 369 391 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 397 419 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 425 447 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 453 475 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 481 503 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 509 531 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 537 559 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 565 587 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 593 615 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 621 643 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 649 671 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 677 699 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 706 727 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 733 755 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 761 783 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 789 811 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:14628291}.
Sequence
MAANGDSPPWSPALAAEGRGSSCEVRRERTPEARIHSVKRYPDLSPGPKGRSSADHAALN
SIVSLQASVSFEDVTVDFSKEEWQHLDPAQRRLYWDVTLENYSHLLSVGYQIPKSEAAFK
LEQGEGPWMLEGEAPHQSCSGEAIGKMQQQGIPGGIFFHCERFDQPIGEDSLCSILEELW
QDNDQLEQRQENQNNLLSHVKVLIKERGYEHKNIEKIIHVTTKLVPSIKRLHNCDTILKH
TLNSHNHNRNSATKNLGKIFGNGNNFPHSPSSTKNENAKTGANSCEHDHYEKHLSHKQAP
THHQKIHPEEKLYVCTECVMGFTQKSHLFEHQRIHAGEKSRECDKSNKVFPQKPQVDVHP
SVYTGEKPYLCTQCGKVFTLKSNLITHQKIHTGQKPYKCSECGKAFFQRSDLFRHLRIHT
GEKPYECSECGKGFSQNSDLSIHQKTHTGEKHYECNECGKAFTRKSALRMHQRIHTGEKP
YVCADCGKAFIQKSHFNTHQRIHTGEKPYECSDCGKSFTKKSQLHVHQRIHTGEKPYICT
ECGKVFTHRTNLTTHQKTH
TGEKPYMCAECGKAFTDQSNLIKHQKTHTGEKPYKCNGCGK
AFIWKSRLKIHQKSH
IGERHYECKDCGKAFIQKSTLSVHQRIHTGEKPYVCPECGKAFIQ
KSHFIAHHRIH
TGEKPYECSDCGKCFTKKSQLRVHQKIHTGEKPNICAECGKAFTDRSNL
ITHQKIH
TREKPYECGDCGKTFTWKSRLNIHQKSHTGERHYECSKCGKAFIQKATLSMHQ
IIH
TGKKPYACTECQKAFTDRSNLIKHQKMHSGEKRYKASD
Sequence length 821
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
13
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Abnormality of neuronal migration Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma - ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
COGNITION DISORDERS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Gastric cancer - ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
2-3 toe syndactyly Syndactyly Of The Toes HPO_DG
★☆☆☆☆
Found in Text Mining only
Attention deficit hyperactivity disorder Attention Deficit Hyperactivity Disorder HPO_DG
★☆☆☆☆
Found in Text Mining only
Autistic behavior Autism HPO_DG
★☆☆☆☆
Found in Text Mining only
Cognition Disorders Cognitive disorder CTD_human_DG 14628291
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cognition Disorders Cognition disorder Pubtator 14628291 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Facial paralysis Facial paralysis HPO_DG
★☆☆☆☆
Found in Text Mining only
Global developmental delay Developmental Delay HPO_DG
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Intellectual Disability Mental retardation BEFREE 14628291
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Intellectual Disability Intellectual developmental disorder Pubtator 14628291, 23871722 Associate
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Macrocephaly Macrocephaly HPO_DG
★☆☆☆☆
Found in Text Mining only