Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7571
Gene name	Zinc finger protein 23
Gene symbol	ZNF23
Synonyms (NCBI Gene)	KOX16ZNF359ZNF612Zfp612
Chromosome	16
Chromosome location	16q22.2

Show/Hide all (58)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029191	hsa-miR-26b-5p	Microarray	19088304
MIRT042854	hsa-miR-324-3p	CLASH	23622248
MIRT564742	hsa-miR-181b-5p	PAR-CLIP	20371350
MIRT564741	hsa-miR-181a-5p	PAR-CLIP	20371350
MIRT564740	hsa-miR-181c-5p	PAR-CLIP	20371350
MIRT564739	hsa-miR-181d-5p	PAR-CLIP	20371350
MIRT564738	hsa-miR-4262	PAR-CLIP	20371350
MIRT564737	hsa-miR-664a-3p	PAR-CLIP	20371350
MIRT564736	hsa-miR-4712-5p	PAR-CLIP	20371350
MIRT564735	hsa-miR-770-5p	PAR-CLIP	20371350
MIRT564734	hsa-miR-6845-3p	PAR-CLIP	20371350
MIRT564733	hsa-miR-6873-3p	PAR-CLIP	20371350
MIRT564732	hsa-miR-4768-5p	PAR-CLIP	20371350
MIRT564731	hsa-miR-6833-3p	PAR-CLIP	20371350
MIRT564730	hsa-miR-6809-3p	PAR-CLIP	20371350
MIRT564742	hsa-miR-181b-5p	PAR-CLIP	20371350
MIRT564741	hsa-miR-181a-5p	PAR-CLIP	20371350
MIRT564740	hsa-miR-181c-5p	PAR-CLIP	20371350
MIRT564739	hsa-miR-181d-5p	PAR-CLIP	20371350
MIRT564738	hsa-miR-4262	PAR-CLIP	20371350
MIRT564737	hsa-miR-664a-3p	PAR-CLIP	20371350
MIRT564736	hsa-miR-4712-5p	PAR-CLIP	20371350
MIRT564735	hsa-miR-770-5p	PAR-CLIP	20371350
MIRT564734	hsa-miR-6845-3p	PAR-CLIP	20371350
MIRT564733	hsa-miR-6873-3p	PAR-CLIP	20371350
MIRT564732	hsa-miR-4768-5p	PAR-CLIP	20371350
MIRT564731	hsa-miR-6833-3p	PAR-CLIP	20371350
MIRT564730	hsa-miR-6809-3p	PAR-CLIP	20371350
MIRT1518762	hsa-miR-1263	CLIP-seq
MIRT1518763	hsa-miR-4263	CLIP-seq
MIRT1518764	hsa-miR-4735-5p	CLIP-seq
MIRT1518765	hsa-miR-576-5p	CLIP-seq
MIRT2156511	hsa-miR-106a	CLIP-seq
MIRT2156512	hsa-miR-106b	CLIP-seq
MIRT2156513	hsa-miR-1291	CLIP-seq
MIRT2156514	hsa-miR-1305	CLIP-seq
MIRT2156515	hsa-miR-136	CLIP-seq
MIRT2156516	hsa-miR-17	CLIP-seq
MIRT2156517	hsa-miR-20a	CLIP-seq
MIRT2156518	hsa-miR-20b	CLIP-seq
MIRT2156519	hsa-miR-300	CLIP-seq
MIRT2156520	hsa-miR-3121-5p	CLIP-seq
MIRT2156521	hsa-miR-328	CLIP-seq
MIRT2156522	hsa-miR-3609	CLIP-seq
MIRT2156523	hsa-miR-3677-5p	CLIP-seq
MIRT2156524	hsa-miR-381	CLIP-seq
MIRT2156525	hsa-miR-4276	CLIP-seq
MIRT2156526	hsa-miR-4796-3p	CLIP-seq
MIRT2156527	hsa-miR-513a-3p	CLIP-seq
MIRT2156528	hsa-miR-515-5p	CLIP-seq
MIRT2156529	hsa-miR-519d	CLIP-seq
MIRT2156530	hsa-miR-548ah	CLIP-seq
MIRT2156531	hsa-miR-607	CLIP-seq
MIRT2156532	hsa-miR-663b	CLIP-seq
MIRT2156533	hsa-miR-93	CLIP-seq
MIRT2156531	hsa-miR-607	CLIP-seq
MIRT2156514	hsa-miR-1305	CLIP-seq
MIRT2156531	hsa-miR-607	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
194527	13023	ENSG00000167377

P17027

Protein name

Zinc finger protein 23 (Zinc finger protein 359) (Zinc finger protein 612) (Zinc finger protein KOX16)

Protein function

May be involved in transcriptional regulation. May have a role in embryonic development.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	196 → 218	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	224 → 246	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	252 → 274	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	308 → 330	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	336 → 358	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	364 → 386	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	392 → 414	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	420 → 442	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	448 → 470	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	476 → 498	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	504 → 526	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	560 → 582	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	588 → 610	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	616 → 638	Zinc finger, C2H2 type	Domain

Sequence

MLENYGNVASLGFPLLKPAVISQLEGGSELGGSSPLAAGTGLQGLQTDIQTDNDLTKEMY
EGKENVSFELQRDFSQETDFSEASLLEKQQEVHSAGNIKKEKSNTIDGTVKDETSPVEEC
FFSQSSNSYQCHTITGEQPSGCTGLGKSISFDTKLVKHEIINSEERPFKCEELVEPFRCD
SQLIQHQENNTEEKPYQCSECGKAFSINEKLIWHQRLHSGEKPFKCVECGKSFSYSSHYI
THQTIHSGEKPYQCKMCGKAFSVNGSLSRHQRIHTGEKPYQCKECGNGFSCSSAYITHQR
VHTGEKPYECNDCGKAFNVNAKLIQHQRIHTGEKPYECNECGKGFRCSSQLRQHQSIHTG
EKPYQCKECGKGFNNNTKLIQHQRIHTGEKPYECTECGKAFSVKGKLIQHQRIHTGEKPY
ECNECGKAFRCNSQFRQHLRIHTGEKPYECNECGKAFSVNGKLMRHQRIHTGEKPFECNE
CGRCFTSKRNLLDHHRIHTGEKPYQCKECGKAFSINAKLTRHQRIHTGEKPFKCMECEKA
FSCSSNYIVHQRIHTGEKPFQCKECGKAFHVNAHLIRHQRSHTGEKPFRCVECGKGFSFS
SDYIIHQTVHTWKKPYMCSVCGKAFRFSFQLSQHQSVHSEGKS

Sequence length

643

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GILLES DE LA TOURETTE SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	30478301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	28848158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	8500793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21965783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	21965783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28848158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30478301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17137575		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28848158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	28848158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	28848158	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18384939		★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF23 (zinc finger protein 23)