Gene Gene information from NCBI Gene database.
Entrez ID 7547
Gene name Zic family zinc finger 3
Gene symbol ZIC3
Synonyms (NCBI Gene)
HTXHTX1VACTERLXZNF203
Chromosome X
Chromosome location Xq26.3
Summary This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. This nuclear protein probably functions as a transcription factor in early stages of left-right body axis formation. Mutations in this gene cause X-linked visceral heterotaxy,
SNPs SNP information provided by dbSNP.
22
SNP ID Visualize variation Clinical significance Consequence
rs104894960 C>T Pathogenic Coding sequence variant, stop gained
rs104894961 G>C Pathogenic Coding sequence variant, missense variant
rs104894962 A>G Pathogenic Coding sequence variant, missense variant
rs122462165 C>T Pathogenic Coding sequence variant, missense variant
rs122462166 C>A Pathogenic Coding sequence variant, stop gained
miRNA miRNA information provided by mirtarbase database.
75
miRTarBase ID miRNA Experiments Reference
MIRT000976 hsa-miR-155-5p Luciferase reporter assay 18367535
MIRT000976 hsa-miR-155-5p Luciferase reporter assay 18367535
MIRT000976 hsa-miR-155-5p Luciferase reporter assay 19177201
MIRT000976 hsa-miR-155-5p Review 20026422
MIRT000976 hsa-miR-155-5p Other 20584899
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
71
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 17764085
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300265 12874 ENSG00000156925
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O60481
Protein name Zinc finger protein ZIC 3 (Zinc finger protein 203) (Zinc finger protein of the cerebellum 3)
Protein function Acts as a transcriptional activator. Required in the earliest stages in both axial midline development and left-right (LR) asymmetry specification. Binds to the minimal GLI-consensus sequence 5'-GGGTGGTC-3'.
PDB 2EJ4 , 2RPC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18366 zf_ZIC 244 290 Zic proteins zinc finger domain Domain
PF00096 zf-C2H2 295 322 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 328 352 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 358 382 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 388 410 Zinc finger, C2H2 type Domain
Sequence
MTMLLDGGPQFPGLGVGSFGAPRHHEMPNREPAGMGLNPFGDSTHAAAAAAAAAAFKLSP
AAAHDLSSGQSSAFTPQGSGYANALGHHHHHHHHHHHTSQVPSYGGAASAAFNSTREFLF
RQRSSGLSEAASGGGQHGLFAGSASSLHAPAGIPEPPSYLLFPGLHEQGAGHPSPTGHVD
NNQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFF
RYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWE
ECPREGKSFKAKYKLVNHIRVH
TGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKC
EFEGCDRRFANSSDRKKHMHVH
TSDKPYICKVCDKSYTHPSSLRKHMKVHESQGSDSSPA
ASSGYESSTPPAIASANSKDTTKTPSAVQTSTSHNPGLPPNFNEWYV
Sequence length 467
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Signaling pathways regulating pluripotency of stem cells   POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation
Transcriptional regulation of pluripotent stem cells
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
12
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Congenital heart defects, multiple types, 1, X-linked Pathogenic rs387906498 RCV000012188
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Heterotaxy, visceral, 1, X-linked Pathogenic; Likely pathogenic rs2124184204, rs2124185586, rs2124184171, rs2521149558, rs2521154725, rs2521150121, rs2521150898, rs886041111, rs122462165, rs122462166, rs104894960, rs104894961, rs104894962, rs2124184319, rs122463168
View all (12 more)
RCV001389078
RCV001387447
RCV001935541
RCV002286594
RCV002470296
View all (23 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
VACTERL association, X-linked, with or without hydrocephalus Likely pathogenic; Pathogenic rs2124185586, rs398122850 RCV001420556
RCV000022847
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ZIC3-related disorder Likely pathogenic rs2521149676 RCV003397374
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BONE DISEASES, DEVELOPMENTAL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Congenital heart defects 1, nonsyndromic, 1 Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CRANIOFACIAL ABNORMALITIES CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DEXTROCARDIA CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Anus, Imperforate Imperforate anus HPO_DG
★☆☆☆☆
Found in Text Mining only
Aortic Aneurysm Aortic Aneurysm BEFREE 30898623
★☆☆☆☆
Found in Text Mining only
Aortic Aneurysm, Abdominal Aortic Aneurysm BEFREE 30898623
★☆☆☆☆
Found in Text Mining only
Atrial Septal Defects Atrial Septal Defect HPO_DG
★☆☆☆☆
Found in Text Mining only
Atrioventricular Septal Defect Atrioventricular septal defect BEFREE 23427188
★☆☆☆☆
Found in Text Mining only
Biliary Atresia Biliary Atresia HPO_DG
★☆☆☆☆
Found in Text Mining only
Bone Diseases, Developmental Bone Disease CTD_human_DG 17127413
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Breast neoplasm Pubtator 29333926 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 26498524
★☆☆☆☆
Found in Text Mining only
Cardiac defects Cardiac Defects BEFREE 16926859
★☆☆☆☆
Found in Text Mining only