Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7539
Gene name	ZFP37 zinc finger protein
Gene symbol	ZFP37
Synonyms (NCBI Gene)	ZNF906zfp-37
Chromosome	9
Chromosome location	9q32
Summary	This gene encodes a transcription factor that belongs to a large family of zinc finger proteins. A similar protein in mouse is thought to play a role in regulating the structures of the nucleolus and centromere in neurons. Alternate splicing results in mu

Show/Hide all (53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044388	hsa-miR-320a	CLASH	23622248
MIRT036645	hsa-miR-935	CLASH	23622248
MIRT550663	hsa-miR-338-5p	PAR-CLIP	21572407
MIRT550662	hsa-miR-383-5p	PAR-CLIP	21572407
MIRT550661	hsa-miR-5694	PAR-CLIP	21572407
MIRT550660	hsa-miR-1244	PAR-CLIP	21572407
MIRT550659	hsa-miR-5692b	PAR-CLIP	21572407
MIRT550658	hsa-miR-5692c	PAR-CLIP	21572407
MIRT550657	hsa-miR-4729	PAR-CLIP	21572407
MIRT550656	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT550655	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT550654	hsa-miR-5696	PAR-CLIP	21572407
MIRT550653	hsa-miR-6869-5p	PAR-CLIP	21572407
MIRT445649	hsa-miR-590-3p	PAR-CLIP	22100165
MIRT445648	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT445647	hsa-miR-4775	PAR-CLIP	22100165
MIRT445649	hsa-miR-590-3p	PAR-CLIP	22100165
MIRT445648	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT445647	hsa-miR-4775	PAR-CLIP	22100165
MIRT550663	hsa-miR-338-5p	PAR-CLIP	21572407
MIRT550662	hsa-miR-383-5p	PAR-CLIP	21572407
MIRT550661	hsa-miR-5694	PAR-CLIP	21572407
MIRT550660	hsa-miR-1244	PAR-CLIP	21572407
MIRT550659	hsa-miR-5692b	PAR-CLIP	21572407
MIRT550658	hsa-miR-5692c	PAR-CLIP	21572407
MIRT550657	hsa-miR-4729	PAR-CLIP	21572407
MIRT550656	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT550655	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT550654	hsa-miR-5696	PAR-CLIP	21572407
MIRT550653	hsa-miR-6869-5p	PAR-CLIP	21572407
MIRT445649	hsa-miR-590-3p	PAR-CLIP	22100165
MIRT445648	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT445647	hsa-miR-4775	PAR-CLIP	22100165
MIRT445649	hsa-miR-590-3p	PAR-CLIP	22100165
MIRT445648	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT445647	hsa-miR-4775	PAR-CLIP	22100165
MIRT1511507	hsa-miR-3065-5p	CLIP-seq
MIRT1511508	hsa-miR-3668	CLIP-seq
MIRT1511509	hsa-miR-3935	CLIP-seq
MIRT1511510	hsa-miR-421	CLIP-seq
MIRT1511511	hsa-miR-4539	CLIP-seq
MIRT1511512	hsa-miR-4731-3p	CLIP-seq
MIRT1511513	hsa-miR-4801	CLIP-seq
MIRT1511514	hsa-miR-495	CLIP-seq
MIRT1511515	hsa-miR-513a-3p	CLIP-seq
MIRT1921109	hsa-miR-1207-3p	CLIP-seq
MIRT1921110	hsa-miR-3149	CLIP-seq
MIRT1921111	hsa-miR-3713	CLIP-seq
MIRT1921109	hsa-miR-1207-3p	CLIP-seq
MIRT1921110	hsa-miR-3149	CLIP-seq
MIRT1921111	hsa-miR-3713	CLIP-seq
MIRT2153964	hsa-miR-1305	CLIP-seq
MIRT1921110	hsa-miR-3149	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	9585434
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	9585434
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	NAS	9585434
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
602951	12863	ENSG00000136866

Q9Y6Q3

Protein name

Zinc finger protein 37 homolog (Zfp-37)

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01352	KRAB	41 → 72	KRAB box	Family
PF00096	zf-C2H2	293 → 315	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	321 → 343	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	377 → 399	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	405 → 427	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	433 → 455	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	461 → 483	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	489 → 511	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	517 → 539	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	545 → 567	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	573 → 595	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	601 → 623	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at low level in several tissues including fetal cartilage.

Sequence

MSVSSGVQILTKPETVDRRRSAETTKEAGRPLEMAVSEPEASAAEWKQLDPAQSNLYNDV
MLENYCNQASMGCQAPKPDMISKLEKGEAPWLGKGKRPSQGCPSKIARPKQKETDGKVQK
DDDQLENIQKSQNKLLREVAVKKKTQAKKNGSDCGSLGKKNNLHKKHVPSKKRLLKFESC
GKILKQNLDLPDHSRNCVKRKSDAAKEHKKSFNHSLSDTRKGKKQTGKKHEKLSSHSSSD
KCNKTGKKHDKLCCHSSSHIKQDKIQTGEKHEKSPSLSSSTKHEKPQACVKPYECNQCGK
VLSHKQGLIDHQRVHTGEKPYECNECGIAFSQKSHLVVHQRTHTGEKPYECIQCGKAHGH
KHALTDHLRIHTGEKPYECAECGKTFRHSSNLIQHVRSHTGEKPYECKECGKSFRYNSSL
TEHVRTHTGEIPYECNECGKAFKYSSSLTKHMRIHTGEKPFECNECGKAFSKKSHLIIHQ
RTHTKEKPYKCNECGKAFGHSSSLTYHMRTHTGESPFECNQCGKGFKQIEGLTQHQRVHT
GEKPYECNECGKAFSQKSHLIVHQRTHTGEKPYECNECEKAFNAKSQLVIHQRSHTGEKP
YECNECGKTFKQNASLTKHVKTHSEDKSHE

Sequence length

630

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acrofacial Dysostosis	Acrofacial Dysostosis	BEFREE	9585434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36360783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Limb Deformities, Congenital	Congenital anomaly of limb	BEFREE	9585434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nager syndrome	Nager Syndrome	BEFREE	9585434		★★★★★ ★☆☆☆☆ Found in Text Mining only

ZFP37 (ZFP37 zinc finger protein)