ZFP36 (ZFP36 ring finger protein)

Gene

• Entrez ID: 7538
• Gene name: ZFP36 ring finger protein
• Gene symbol: ZFP36
• Synonyms (NCBI Gene): G0S24, GOS24, NUP475, RNF162A, TIS11, TTP, zfp-36
• Chromosome: 19
• Chromosome location: 19q13.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004630	hsa-miR-29a-3p	Review	20026422
MIRT004632	hsa-miR-29c-3p	Review	20026422
MIRT016689	hsa-miR-346	Western blot;qRT-PCR;Other	21611196
MIRT004630	hsa-miR-29a-3p	GFP reporter assay	24103357
MIRT004630	hsa-miR-29a-3p	Luciferase reporter assay	23401122
MIRT004630	hsa-miR-29a-3p	Luciferase reporter assay	23401122
MIRT004630	hsa-miR-29a-3p	Luciferase reporter assay	23401122
MIRT004630	hsa-miR-29a-3p	Luciferase reporter assay	23401122
MIRT503247	hsa-miR-6888-5p	HITS-CLIP	23313552
MIRT503246	hsa-miR-126-5p	HITS-CLIP	23313552
MIRT697426	hsa-miR-605-3p	HITS-CLIP	23313552
MIRT697425	hsa-miR-4493	HITS-CLIP	23313552
MIRT503245	hsa-miR-4524a-3p	HITS-CLIP	23313552
MIRT503244	hsa-miR-4795-3p	HITS-CLIP	23313552
MIRT503243	hsa-miR-513a-5p	HITS-CLIP	23313552
MIRT503242	hsa-miR-27a-3p	HITS-CLIP	23313552
MIRT503241	hsa-miR-27b-3p	HITS-CLIP	23313552
MIRT697423	hsa-miR-6126	HITS-CLIP	23313552
MIRT697424	hsa-miR-17-3p	HITS-CLIP	23313552
MIRT503247	hsa-miR-6888-5p	PAR-CLIP	23446348
MIRT503246	hsa-miR-126-5p	PAR-CLIP	23446348
MIRT503245	hsa-miR-4524a-3p	PAR-CLIP	23446348
MIRT503244	hsa-miR-4795-3p	PAR-CLIP	23446348
MIRT503243	hsa-miR-513a-5p	PAR-CLIP	23446348
MIRT503242	hsa-miR-27a-3p	PAR-CLIP	23446348
MIRT503241	hsa-miR-27b-3p	PAR-CLIP	23446348
MIRT485900	hsa-miR-5700	PAR-CLIP	23592263
MIRT485899	hsa-miR-586	PAR-CLIP	23592263
MIRT485898	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT485897	hsa-miR-4481	PAR-CLIP	23592263
MIRT485896	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT485895	hsa-miR-6793-5p	PAR-CLIP	23592263
MIRT485894	hsa-miR-569	PAR-CLIP	23592263
MIRT485893	hsa-miR-155-5p	PAR-CLIP	23592263
MIRT485892	hsa-miR-1299	PAR-CLIP	23592263
MIRT485891	hsa-miR-516b-5p	PAR-CLIP	23592263
MIRT485890	hsa-miR-4782-5p	PAR-CLIP	23592263
MIRT485889	hsa-miR-5706	PAR-CLIP	23592263
MIRT004630	hsa-miR-29a-3p	Luciferase reporter assay, Western blot	26356262
MIRT503246	hsa-miR-126-5p	PAR-CLIP	26701625
MIRT503246	hsa-miR-126-5p	PAR-CLIP	26701625
MIRT503242	hsa-miR-27a-3p	PAR-CLIP	26701625
MIRT503242	hsa-miR-27a-3p	PAR-CLIP	26701625
MIRT503241	hsa-miR-27b-3p	PAR-CLIP	26701625
MIRT503241	hsa-miR-27b-3p	PAR-CLIP	26701625
MIRT697425	hsa-miR-4493	PAR-CLIP	26701625
MIRT697425	hsa-miR-4493	PAR-CLIP	26701625
MIRT503245	hsa-miR-4524a-3p	PAR-CLIP	26701625
MIRT503245	hsa-miR-4524a-3p	PAR-CLIP	26701625
MIRT503244	hsa-miR-4795-3p	PAR-CLIP	26701625
MIRT503244	hsa-miR-4795-3p	PAR-CLIP	26701625
MIRT503243	hsa-miR-513a-5p	PAR-CLIP	26701625
MIRT503243	hsa-miR-513a-5p	PAR-CLIP	26701625
MIRT503247	hsa-miR-6888-5p	PAR-CLIP	26701625
MIRT503247	hsa-miR-6888-5p	PAR-CLIP	26701625
MIRT503247	hsa-miR-6888-5p	HITS-CLIP	23313552
MIRT503246	hsa-miR-126-5p	HITS-CLIP	23313552
MIRT697426	hsa-miR-605-3p	HITS-CLIP	23313552
MIRT697425	hsa-miR-4493	HITS-CLIP	23313552
MIRT503245	hsa-miR-4524a-3p	HITS-CLIP	23313552
MIRT503244	hsa-miR-4795-3p	HITS-CLIP	23313552
MIRT503243	hsa-miR-513a-5p	HITS-CLIP	23313552
MIRT503242	hsa-miR-27a-3p	HITS-CLIP	23313552
MIRT503241	hsa-miR-27b-3p	HITS-CLIP	23313552
MIRT697423	hsa-miR-6126	HITS-CLIP	23313552
MIRT697424	hsa-miR-17-3p	HITS-CLIP	23313552
MIRT503247	hsa-miR-6888-5p	PAR-CLIP	23446348
MIRT503246	hsa-miR-126-5p	PAR-CLIP	23446348
MIRT503245	hsa-miR-4524a-3p	PAR-CLIP	23446348
MIRT503244	hsa-miR-4795-3p	PAR-CLIP	23446348
MIRT503243	hsa-miR-513a-5p	PAR-CLIP	23446348
MIRT503242	hsa-miR-27a-3p	PAR-CLIP	23446348
MIRT503241	hsa-miR-27b-3p	PAR-CLIP	23446348
MIRT485900	hsa-miR-5700	PAR-CLIP	23592263
MIRT485899	hsa-miR-586	PAR-CLIP	23592263
MIRT485898	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT485897	hsa-miR-4481	PAR-CLIP	23592263
MIRT485896	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT485895	hsa-miR-6793-5p	PAR-CLIP	23592263
MIRT485894	hsa-miR-569	PAR-CLIP	23592263
MIRT485893	hsa-miR-155-5p	PAR-CLIP	23592263
MIRT485892	hsa-miR-1299	PAR-CLIP	23592263
MIRT485891	hsa-miR-516b-5p	PAR-CLIP	23592263
MIRT485890	hsa-miR-4782-5p	PAR-CLIP	23592263
MIRT485889	hsa-miR-5706	PAR-CLIP	23592263
MIRT755395	hsa-miR-934	Luciferase reporter assay	37744530
MIRT755701	hsa-miR-182-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunohistochemistry (IHC)	36148947
MIRT1510855	hsa-miR-1271	CLIP-seq
MIRT1510856	hsa-miR-1279	CLIP-seq
MIRT1510857	hsa-miR-128	CLIP-seq
MIRT1510858	hsa-miR-1293	CLIP-seq
MIRT1510859	hsa-miR-1294	CLIP-seq
MIRT1510860	hsa-miR-1305	CLIP-seq
MIRT1510861	hsa-miR-130a	CLIP-seq
MIRT1510862	hsa-miR-130b	CLIP-seq
MIRT1510863	hsa-miR-140-3p	CLIP-seq
MIRT1510864	hsa-miR-142-5p	CLIP-seq
MIRT1510865	hsa-miR-145	CLIP-seq
MIRT1510866	hsa-miR-148a	CLIP-seq
MIRT1510867	hsa-miR-148b	CLIP-seq
MIRT1510868	hsa-miR-152	CLIP-seq
MIRT1510869	hsa-miR-155	CLIP-seq
MIRT1510870	hsa-miR-182	CLIP-seq
MIRT1510871	hsa-miR-1913	CLIP-seq
MIRT1510872	hsa-miR-200b	CLIP-seq
MIRT1510873	hsa-miR-200c	CLIP-seq
MIRT1510874	hsa-miR-2110	CLIP-seq
MIRT1510875	hsa-miR-221	CLIP-seq
MIRT1510876	hsa-miR-222	CLIP-seq
MIRT1510877	hsa-miR-2467-3p	CLIP-seq
MIRT1510878	hsa-miR-27a	CLIP-seq
MIRT1510879	hsa-miR-27b	CLIP-seq
MIRT1510880	hsa-miR-29a	CLIP-seq
MIRT1510881	hsa-miR-29b	CLIP-seq
MIRT1510882	hsa-miR-29c	CLIP-seq
MIRT1510883	hsa-miR-300	CLIP-seq
MIRT1510884	hsa-miR-301a	CLIP-seq
MIRT1510885	hsa-miR-301b	CLIP-seq
MIRT1510886	hsa-miR-3115	CLIP-seq
MIRT1510887	hsa-miR-3121-3p	CLIP-seq
MIRT1510888	hsa-miR-3140-3p	CLIP-seq
MIRT1510889	hsa-miR-3144-5p	CLIP-seq
MIRT1510890	hsa-miR-3146	CLIP-seq
MIRT1510891	hsa-miR-3148	CLIP-seq
MIRT1510892	hsa-miR-3150a-3p	CLIP-seq
MIRT1510893	hsa-miR-3150a-5p	CLIP-seq
MIRT1510894	hsa-miR-3150b-5p	CLIP-seq
MIRT1510895	hsa-miR-3163	CLIP-seq
MIRT1510896	hsa-miR-3170	CLIP-seq
MIRT1510897	hsa-miR-3184	CLIP-seq
MIRT1510898	hsa-miR-3189-5p	CLIP-seq
MIRT1510899	hsa-miR-3191	CLIP-seq
MIRT1510900	hsa-miR-324-3p	CLIP-seq
MIRT1510901	hsa-miR-337-5p	CLIP-seq
MIRT1510902	hsa-miR-34a	CLIP-seq
MIRT1510903	hsa-miR-34c-5p	CLIP-seq
MIRT1510904	hsa-miR-3613-3p	CLIP-seq
MIRT1510905	hsa-miR-361-3p	CLIP-seq
MIRT1510906	hsa-miR-3614-5p	CLIP-seq
MIRT1510907	hsa-miR-3649	CLIP-seq
MIRT1510908	hsa-miR-365	CLIP-seq
MIRT1510909	hsa-miR-3663-3p	CLIP-seq
MIRT1510910	hsa-miR-3664-3p	CLIP-seq
MIRT1510911	hsa-miR-3666	CLIP-seq
MIRT1510912	hsa-miR-3678-3p	CLIP-seq
MIRT1510913	hsa-miR-3679-3p	CLIP-seq
MIRT1510914	hsa-miR-3691-3p	CLIP-seq
MIRT1510915	hsa-miR-369-3p	CLIP-seq
MIRT1510916	hsa-miR-374a	CLIP-seq
MIRT1510917	hsa-miR-374b	CLIP-seq
MIRT1510918	hsa-miR-381	CLIP-seq
MIRT1510919	hsa-miR-410	CLIP-seq
MIRT1510920	hsa-miR-423-5p	CLIP-seq
MIRT1510921	hsa-miR-4256	CLIP-seq
MIRT1510922	hsa-miR-4267	CLIP-seq
MIRT1510923	hsa-miR-4286	CLIP-seq
MIRT1510924	hsa-miR-429	CLIP-seq
MIRT1510925	hsa-miR-4295	CLIP-seq
MIRT1510926	hsa-miR-4327	CLIP-seq
MIRT1510927	hsa-miR-4330	CLIP-seq
MIRT1510928	hsa-miR-4433	CLIP-seq
MIRT1510929	hsa-miR-4443	CLIP-seq
MIRT1510930	hsa-miR-4445	CLIP-seq
MIRT1510931	hsa-miR-4446-5p	CLIP-seq
MIRT1510932	hsa-miR-4450	CLIP-seq
MIRT1510933	hsa-miR-4459	CLIP-seq
MIRT1510934	hsa-miR-4477b	CLIP-seq
MIRT1510935	hsa-miR-4483	CLIP-seq
MIRT1510936	hsa-miR-449a	CLIP-seq
MIRT1510937	hsa-miR-449b	CLIP-seq
MIRT1510938	hsa-miR-454	CLIP-seq
MIRT1510939	hsa-miR-4652-5p	CLIP-seq
MIRT1510940	hsa-miR-4668-3p	CLIP-seq
MIRT1510941	hsa-miR-4688	CLIP-seq
MIRT1510942	hsa-miR-4693-5p	CLIP-seq
MIRT1510943	hsa-miR-4696	CLIP-seq
MIRT1510944	hsa-miR-4733-3p	CLIP-seq
MIRT1510945	hsa-miR-4758-3p	CLIP-seq
MIRT1510946	hsa-miR-4768-3p	CLIP-seq
MIRT1510947	hsa-miR-4786-5p	CLIP-seq
MIRT1510948	hsa-miR-4796-5p	CLIP-seq
MIRT1510949	hsa-miR-486-3p	CLIP-seq
MIRT1510950	hsa-miR-492	CLIP-seq
MIRT1510951	hsa-miR-516b	CLIP-seq
MIRT1510952	hsa-miR-520d-5p	CLIP-seq
MIRT1510953	hsa-miR-524-5p	CLIP-seq
MIRT1510954	hsa-miR-548a-3p	CLIP-seq
MIRT1510955	hsa-miR-548ac	CLIP-seq
MIRT1510956	hsa-miR-548ae	CLIP-seq
MIRT1510957	hsa-miR-548ag	CLIP-seq
MIRT1510958	hsa-miR-548ai	CLIP-seq
MIRT1510959	hsa-miR-548aj	CLIP-seq
MIRT1510960	hsa-miR-548am	CLIP-seq
MIRT1510961	hsa-miR-548b-3p	CLIP-seq
MIRT1510962	hsa-miR-548c-3p	CLIP-seq
MIRT1510963	hsa-miR-548d-3p	CLIP-seq
MIRT1510964	hsa-miR-548e	CLIP-seq
MIRT1510965	hsa-miR-548f	CLIP-seq
MIRT1510966	hsa-miR-548v	CLIP-seq
MIRT1510967	hsa-miR-548x	CLIP-seq
MIRT1510968	hsa-miR-548z	CLIP-seq
MIRT1510969	hsa-miR-551a	CLIP-seq
MIRT1510970	hsa-miR-551b	CLIP-seq
MIRT1510971	hsa-miR-624	CLIP-seq
MIRT1510972	hsa-miR-656	CLIP-seq
MIRT1510973	hsa-miR-665	CLIP-seq
MIRT1510974	hsa-miR-7	CLIP-seq
MIRT1510975	hsa-miR-875-3p	CLIP-seq
MIRT755395	hsa-miR-934	CLIP-seq
MIRT1510976	hsa-miR-935	CLIP-seq
MIRT1510977	hsa-miR-944	CLIP-seq
MIRT1510978	hsa-miR-96	CLIP-seq
MIRT1510865	hsa-miR-145	CLIP-seq
MIRT1510880	hsa-miR-29a	CLIP-seq
MIRT1510881	hsa-miR-29b	CLIP-seq
MIRT1510882	hsa-miR-29c	CLIP-seq
MIRT1510888	hsa-miR-3140-3p	CLIP-seq
MIRT1510909	hsa-miR-3663-3p	CLIP-seq
MIRT1510910	hsa-miR-3664-3p	CLIP-seq
MIRT1510913	hsa-miR-3679-3p	CLIP-seq
MIRT1510928	hsa-miR-4433	CLIP-seq
MIRT1510929	hsa-miR-4443	CLIP-seq
MIRT1510933	hsa-miR-4459	CLIP-seq
MIRT1510944	hsa-miR-4733-3p	CLIP-seq
MIRT1510946	hsa-miR-4768-3p	CLIP-seq
MIRT1555755	hsa-miR-625	CLIP-seq
MIRT1510976	hsa-miR-935	CLIP-seq
MIRT1510855	hsa-miR-1271	CLIP-seq
MIRT1510858	hsa-miR-1293	CLIP-seq
MIRT1510859	hsa-miR-1294	CLIP-seq
MIRT1510860	hsa-miR-1305	CLIP-seq
MIRT1510864	hsa-miR-142-5p	CLIP-seq
MIRT1510865	hsa-miR-145	CLIP-seq
MIRT1510869	hsa-miR-155	CLIP-seq
MIRT1510870	hsa-miR-182	CLIP-seq
MIRT1510871	hsa-miR-1913	CLIP-seq
MIRT1510872	hsa-miR-200b	CLIP-seq
MIRT1510873	hsa-miR-200c	CLIP-seq
MIRT1510874	hsa-miR-2110	CLIP-seq
MIRT1510878	hsa-miR-27a	CLIP-seq
MIRT1510879	hsa-miR-27b	CLIP-seq
MIRT1510880	hsa-miR-29a	CLIP-seq
MIRT1510881	hsa-miR-29b	CLIP-seq
MIRT1510882	hsa-miR-29c	CLIP-seq
MIRT1510886	hsa-miR-3115	CLIP-seq
MIRT1510888	hsa-miR-3140-3p	CLIP-seq
MIRT1510889	hsa-miR-3144-5p	CLIP-seq
MIRT1510891	hsa-miR-3148	CLIP-seq
MIRT1510892	hsa-miR-3150a-3p	CLIP-seq
MIRT1510895	hsa-miR-3163	CLIP-seq
MIRT1510896	hsa-miR-3170	CLIP-seq
MIRT1510897	hsa-miR-3184	CLIP-seq
MIRT1510898	hsa-miR-3189-5p	CLIP-seq
MIRT1510899	hsa-miR-3191	CLIP-seq
MIRT1510900	hsa-miR-324-3p	CLIP-seq
MIRT1510901	hsa-miR-337-5p	CLIP-seq
MIRT1510902	hsa-miR-34a	CLIP-seq
MIRT1510903	hsa-miR-34c-5p	CLIP-seq
MIRT1510905	hsa-miR-361-3p	CLIP-seq
MIRT1510906	hsa-miR-3614-5p	CLIP-seq
MIRT1510907	hsa-miR-3649	CLIP-seq
MIRT1510909	hsa-miR-3663-3p	CLIP-seq
MIRT1510910	hsa-miR-3664-3p	CLIP-seq
MIRT1510914	hsa-miR-3691-3p	CLIP-seq
MIRT1510915	hsa-miR-369-3p	CLIP-seq
MIRT1510916	hsa-miR-374a	CLIP-seq
MIRT1510917	hsa-miR-374b	CLIP-seq
MIRT1510920	hsa-miR-423-5p	CLIP-seq
MIRT1510923	hsa-miR-4286	CLIP-seq
MIRT2153933	hsa-miR-4287	CLIP-seq
MIRT1510924	hsa-miR-429	CLIP-seq
MIRT1510928	hsa-miR-4433	CLIP-seq
MIRT1510929	hsa-miR-4443	CLIP-seq
MIRT1510932	hsa-miR-4450	CLIP-seq
MIRT1510933	hsa-miR-4459	CLIP-seq
MIRT1510935	hsa-miR-4483	CLIP-seq
MIRT1510936	hsa-miR-449a	CLIP-seq
MIRT1510937	hsa-miR-449b	CLIP-seq
MIRT1510939	hsa-miR-4652-5p	CLIP-seq
MIRT2153934	hsa-miR-4685-3p	CLIP-seq
MIRT1510941	hsa-miR-4688	CLIP-seq
MIRT1510942	hsa-miR-4693-5p	CLIP-seq
MIRT1510944	hsa-miR-4733-3p	CLIP-seq
MIRT1510945	hsa-miR-4758-3p	CLIP-seq
MIRT1510946	hsa-miR-4768-3p	CLIP-seq
MIRT1510948	hsa-miR-4796-5p	CLIP-seq
MIRT1510949	hsa-miR-486-3p	CLIP-seq
MIRT1510950	hsa-miR-492	CLIP-seq
MIRT1510951	hsa-miR-516b	CLIP-seq
MIRT1510954	hsa-miR-548a-3p	CLIP-seq
MIRT1510955	hsa-miR-548ac	CLIP-seq
MIRT1510956	hsa-miR-548ae	CLIP-seq
MIRT1510959	hsa-miR-548aj	CLIP-seq
MIRT1510960	hsa-miR-548am	CLIP-seq
MIRT1510963	hsa-miR-548d-3p	CLIP-seq
MIRT1510964	hsa-miR-548e	CLIP-seq
MIRT1510965	hsa-miR-548f	CLIP-seq
MIRT1510967	hsa-miR-548x	CLIP-seq
MIRT1510968	hsa-miR-548z	CLIP-seq
MIRT1555755	hsa-miR-625	CLIP-seq
MIRT1510972	hsa-miR-656	CLIP-seq
MIRT1510973	hsa-miR-665	CLIP-seq
MIRT1510974	hsa-miR-7	CLIP-seq
MIRT1510975	hsa-miR-875-3p	CLIP-seq
MIRT755395	hsa-miR-934	CLIP-seq
MIRT1510976	hsa-miR-935	CLIP-seq
MIRT1510977	hsa-miR-944	CLIP-seq
MIRT1510978	hsa-miR-96	CLIP-seq
MIRT1510855	hsa-miR-1271	CLIP-seq
MIRT1510856	hsa-miR-1279	CLIP-seq
MIRT1510858	hsa-miR-1293	CLIP-seq
MIRT1510859	hsa-miR-1294	CLIP-seq
MIRT1510860	hsa-miR-1305	CLIP-seq
MIRT1510864	hsa-miR-142-5p	CLIP-seq
MIRT1510865	hsa-miR-145	CLIP-seq
MIRT1510869	hsa-miR-155	CLIP-seq
MIRT1510870	hsa-miR-182	CLIP-seq
MIRT1510871	hsa-miR-1913	CLIP-seq
MIRT1510872	hsa-miR-200b	CLIP-seq
MIRT1510873	hsa-miR-200c	CLIP-seq
MIRT1510874	hsa-miR-2110	CLIP-seq
MIRT1510878	hsa-miR-27a	CLIP-seq
MIRT1510879	hsa-miR-27b	CLIP-seq
MIRT1510880	hsa-miR-29a	CLIP-seq
MIRT1510881	hsa-miR-29b	CLIP-seq
MIRT1510882	hsa-miR-29c	CLIP-seq
MIRT1510886	hsa-miR-3115	CLIP-seq
MIRT1510888	hsa-miR-3140-3p	CLIP-seq
MIRT1510889	hsa-miR-3144-5p	CLIP-seq
MIRT1510892	hsa-miR-3150a-3p	CLIP-seq
MIRT1510895	hsa-miR-3163	CLIP-seq
MIRT1510896	hsa-miR-3170	CLIP-seq
MIRT1510897	hsa-miR-3184	CLIP-seq
MIRT1510898	hsa-miR-3189-5p	CLIP-seq
MIRT1510899	hsa-miR-3191	CLIP-seq
MIRT1510900	hsa-miR-324-3p	CLIP-seq
MIRT1510901	hsa-miR-337-5p	CLIP-seq
MIRT1510902	hsa-miR-34a	CLIP-seq
MIRT1510903	hsa-miR-34c-5p	CLIP-seq
MIRT1510905	hsa-miR-361-3p	CLIP-seq
MIRT1510906	hsa-miR-3614-5p	CLIP-seq
MIRT1510907	hsa-miR-3649	CLIP-seq
MIRT1510909	hsa-miR-3663-3p	CLIP-seq
MIRT1510910	hsa-miR-3664-3p	CLIP-seq
MIRT1510913	hsa-miR-3679-3p	CLIP-seq
MIRT1510915	hsa-miR-369-3p	CLIP-seq
MIRT1510916	hsa-miR-374a	CLIP-seq
MIRT1510917	hsa-miR-374b	CLIP-seq
MIRT1510920	hsa-miR-423-5p	CLIP-seq
MIRT2153933	hsa-miR-4287	CLIP-seq
MIRT1510924	hsa-miR-429	CLIP-seq
MIRT1510926	hsa-miR-4327	CLIP-seq
MIRT1510928	hsa-miR-4433	CLIP-seq
MIRT1510929	hsa-miR-4443	CLIP-seq
MIRT1510933	hsa-miR-4459	CLIP-seq
MIRT1510935	hsa-miR-4483	CLIP-seq
MIRT1510936	hsa-miR-449a	CLIP-seq
MIRT1510937	hsa-miR-449b	CLIP-seq
MIRT1510939	hsa-miR-4652-5p	CLIP-seq
MIRT2153934	hsa-miR-4685-3p	CLIP-seq
MIRT1510941	hsa-miR-4688	CLIP-seq
MIRT1510944	hsa-miR-4733-3p	CLIP-seq
MIRT1510945	hsa-miR-4758-3p	CLIP-seq
MIRT1510946	hsa-miR-4768-3p	CLIP-seq
MIRT1510948	hsa-miR-4796-5p	CLIP-seq
MIRT1510949	hsa-miR-486-3p	CLIP-seq
MIRT1510950	hsa-miR-492	CLIP-seq
MIRT1510954	hsa-miR-548a-3p	CLIP-seq
MIRT1510955	hsa-miR-548ac	CLIP-seq
MIRT1510956	hsa-miR-548ae	CLIP-seq
MIRT1510959	hsa-miR-548aj	CLIP-seq
MIRT1510960	hsa-miR-548am	CLIP-seq
MIRT1510963	hsa-miR-548d-3p	CLIP-seq
MIRT1510964	hsa-miR-548e	CLIP-seq
MIRT1510965	hsa-miR-548f	CLIP-seq
MIRT1510967	hsa-miR-548x	CLIP-seq
MIRT1510968	hsa-miR-548z	CLIP-seq
MIRT1555755	hsa-miR-625	CLIP-seq
MIRT1510972	hsa-miR-656	CLIP-seq
MIRT1510974	hsa-miR-7	CLIP-seq
MIRT755395	hsa-miR-934	CLIP-seq
MIRT1510976	hsa-miR-935	CLIP-seq
MIRT1510977	hsa-miR-944	CLIP-seq
MIRT1510978	hsa-miR-96	CLIP-seq
MIRT1510855	hsa-miR-1271	CLIP-seq
MIRT1510859	hsa-miR-1294	CLIP-seq
MIRT1510869	hsa-miR-155	CLIP-seq
MIRT1510870	hsa-miR-182	CLIP-seq
MIRT1510871	hsa-miR-1913	CLIP-seq
MIRT1510889	hsa-miR-3144-5p	CLIP-seq
MIRT1510898	hsa-miR-3189-5p	CLIP-seq
MIRT1510899	hsa-miR-3191	CLIP-seq
MIRT1510900	hsa-miR-324-3p	CLIP-seq
MIRT1510901	hsa-miR-337-5p	CLIP-seq
MIRT1510907	hsa-miR-3649	CLIP-seq
MIRT1510939	hsa-miR-4652-5p	CLIP-seq
MIRT1510945	hsa-miR-4758-3p	CLIP-seq
MIRT1510950	hsa-miR-492	CLIP-seq
MIRT1555755	hsa-miR-625	CLIP-seq
MIRT1510978	hsa-miR-96	CLIP-seq
MIRT1510860	hsa-miR-1305	CLIP-seq
MIRT1510875	hsa-miR-221	CLIP-seq
MIRT1510876	hsa-miR-222	CLIP-seq
MIRT1510878	hsa-miR-27a	CLIP-seq
MIRT1510879	hsa-miR-27b	CLIP-seq
MIRT1510883	hsa-miR-300	CLIP-seq
MIRT1510887	hsa-miR-3121-3p	CLIP-seq
MIRT1510893	hsa-miR-3150a-5p	CLIP-seq
MIRT1510894	hsa-miR-3150b-5p	CLIP-seq
MIRT1510895	hsa-miR-3163	CLIP-seq
MIRT1510897	hsa-miR-3184	CLIP-seq
MIRT1510902	hsa-miR-34a	CLIP-seq
MIRT1510903	hsa-miR-34c-5p	CLIP-seq
MIRT1510904	hsa-miR-3613-3p	CLIP-seq
MIRT1510905	hsa-miR-361-3p	CLIP-seq
MIRT1510908	hsa-miR-365	CLIP-seq
MIRT1510913	hsa-miR-3679-3p	CLIP-seq
MIRT1510914	hsa-miR-3691-3p	CLIP-seq
MIRT1510915	hsa-miR-369-3p	CLIP-seq
MIRT1510916	hsa-miR-374a	CLIP-seq
MIRT1510917	hsa-miR-374b	CLIP-seq
MIRT1510918	hsa-miR-381	CLIP-seq
MIRT1510920	hsa-miR-423-5p	CLIP-seq
MIRT1510923	hsa-miR-4286	CLIP-seq
MIRT2434989	hsa-miR-4292	CLIP-seq
MIRT1510927	hsa-miR-4330	CLIP-seq
MIRT1510930	hsa-miR-4445	CLIP-seq
MIRT1510931	hsa-miR-4446-5p	CLIP-seq
MIRT1510934	hsa-miR-4477b	CLIP-seq
MIRT1510936	hsa-miR-449a	CLIP-seq
MIRT1510937	hsa-miR-449b	CLIP-seq
MIRT1510941	hsa-miR-4688	CLIP-seq
MIRT1510948	hsa-miR-4796-5p	CLIP-seq
MIRT1510949	hsa-miR-486-3p	CLIP-seq
MIRT1510952	hsa-miR-520d-5p	CLIP-seq
MIRT1510953	hsa-miR-524-5p	CLIP-seq
MIRT1510954	hsa-miR-548a-3p	CLIP-seq
MIRT1510955	hsa-miR-548ac	CLIP-seq
MIRT1510956	hsa-miR-548ae	CLIP-seq
MIRT1510957	hsa-miR-548ag	CLIP-seq
MIRT1510958	hsa-miR-548ai	CLIP-seq
MIRT1510959	hsa-miR-548aj	CLIP-seq
MIRT1510960	hsa-miR-548am	CLIP-seq
MIRT1510961	hsa-miR-548b-3p	CLIP-seq
MIRT1510962	hsa-miR-548c-3p	CLIP-seq
MIRT1510963	hsa-miR-548d-3p	CLIP-seq
MIRT1510964	hsa-miR-548e	CLIP-seq
MIRT1510965	hsa-miR-548f	CLIP-seq
MIRT1510966	hsa-miR-548v	CLIP-seq
MIRT1510967	hsa-miR-548x	CLIP-seq
MIRT1510968	hsa-miR-548z	CLIP-seq
MIRT2434990	hsa-miR-615-5p	CLIP-seq
MIRT1510971	hsa-miR-624	CLIP-seq
MIRT1510972	hsa-miR-656	CLIP-seq
MIRT1510974	hsa-miR-7	CLIP-seq
MIRT755395	hsa-miR-934	CLIP-seq
MIRT1510977	hsa-miR-944	CLIP-seq
MIRT1510855	hsa-miR-1271	CLIP-seq
MIRT1510865	hsa-miR-145	CLIP-seq
MIRT1510870	hsa-miR-182	CLIP-seq
MIRT1510875	hsa-miR-221	CLIP-seq
MIRT1510876	hsa-miR-222	CLIP-seq
MIRT1510877	hsa-miR-2467-3p	CLIP-seq
MIRT1510880	hsa-miR-29a	CLIP-seq
MIRT1510881	hsa-miR-29b	CLIP-seq
MIRT1510882	hsa-miR-29c	CLIP-seq
MIRT1510888	hsa-miR-3140-3p	CLIP-seq
MIRT1510890	hsa-miR-3146	CLIP-seq
MIRT1510893	hsa-miR-3150a-5p	CLIP-seq
MIRT1510894	hsa-miR-3150b-5p	CLIP-seq
MIRT1510895	hsa-miR-3163	CLIP-seq
MIRT1510897	hsa-miR-3184	CLIP-seq
MIRT1510901	hsa-miR-337-5p	CLIP-seq
MIRT1510902	hsa-miR-34a	CLIP-seq
MIRT1510903	hsa-miR-34c-5p	CLIP-seq
MIRT1510905	hsa-miR-361-3p	CLIP-seq
MIRT1510909	hsa-miR-3663-3p	CLIP-seq
MIRT1510910	hsa-miR-3664-3p	CLIP-seq
MIRT1510912	hsa-miR-3678-3p	CLIP-seq
MIRT1510913	hsa-miR-3679-3p	CLIP-seq
MIRT1510920	hsa-miR-423-5p	CLIP-seq
MIRT2153933	hsa-miR-4287	CLIP-seq
MIRT2434989	hsa-miR-4292	CLIP-seq
MIRT1510927	hsa-miR-4330	CLIP-seq
MIRT1510928	hsa-miR-4433	CLIP-seq
MIRT1510929	hsa-miR-4443	CLIP-seq
MIRT1510930	hsa-miR-4445	CLIP-seq
MIRT1510931	hsa-miR-4446-5p	CLIP-seq
MIRT1510933	hsa-miR-4459	CLIP-seq
MIRT1510936	hsa-miR-449a	CLIP-seq
MIRT1510937	hsa-miR-449b	CLIP-seq
MIRT2153934	hsa-miR-4685-3p	CLIP-seq
MIRT1510941	hsa-miR-4688	CLIP-seq
MIRT1510944	hsa-miR-4733-3p	CLIP-seq
MIRT1510946	hsa-miR-4768-3p	CLIP-seq
MIRT1510947	hsa-miR-4786-5p	CLIP-seq
MIRT1510948	hsa-miR-4796-5p	CLIP-seq
MIRT1510949	hsa-miR-486-3p	CLIP-seq
MIRT1510954	hsa-miR-548a-3p	CLIP-seq
MIRT1510955	hsa-miR-548ac	CLIP-seq
MIRT1510956	hsa-miR-548ae	CLIP-seq
MIRT1510959	hsa-miR-548aj	CLIP-seq
MIRT1510960	hsa-miR-548am	CLIP-seq
MIRT1510961	hsa-miR-548b-3p	CLIP-seq
MIRT1510962	hsa-miR-548c-3p	CLIP-seq
MIRT1510963	hsa-miR-548d-3p	CLIP-seq
MIRT1510964	hsa-miR-548e	CLIP-seq
MIRT1510965	hsa-miR-548f	CLIP-seq
MIRT1510966	hsa-miR-548v	CLIP-seq
MIRT1510967	hsa-miR-548x	CLIP-seq
MIRT1510968	hsa-miR-548z	CLIP-seq
MIRT2434990	hsa-miR-615-5p	CLIP-seq
MIRT1555755	hsa-miR-625	CLIP-seq
MIRT1510973	hsa-miR-665	CLIP-seq
MIRT1510974	hsa-miR-7	CLIP-seq
MIRT1510976	hsa-miR-935	CLIP-seq
MIRT1510978	hsa-miR-96	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ELK1	Unknown	22433566
SMAD3	Unknown	12754205
SMAD4	Unknown	12754205
STAT3	Activation	21606497

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	21784977
GO:0000165	Process	MAPK cascade	IEA
GO:0000165	Process	MAPK cascade	IMP	15187101
GO:0000165	Process	MAPK cascade	ISS
GO:0000178	Component	Exosome (RNase complex)	IDA	11719186
GO:0000288	Process	Nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	23644599
GO:0000289	Process	Nuclear-transcribed mRNA poly(A) tail shortening	IMP	23644599
GO:0000932	Component	P-body	IDA	17369404, 21964062
GO:0000932	Component	P-body	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IDA	11782475, 15687258
GO:0003729	Function	MRNA binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	IEA
GO:0005515	Function	Protein binding	IPI	14679154, 14766228, 15687258, 15766526, 16126846, 16364915, 20221403, 21784977, 21964062, 23644599, 25106868, 27107012, 31439631, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	10330172, 12198173, 14679154
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	10330172, 12198173, 14679154, 14766228, 15634918, 20221403, 21784977, 25038453
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9703499
GO:0005829	Component	Cytosol	IDA	10751406
GO:0005829	Component	Cytosol	TAS
GO:0006402	Process	MRNA catabolic process	IDA	10751406, 11782475
GO:0006402	Process	MRNA catabolic process	IDA	10330172, 20221403
GO:0006402	Process	MRNA catabolic process	TAS	9703499
GO:0008270	Function	Zinc ion binding	IEA
GO:0009611	Process	Response to wounding	IDA	27182009
GO:0009611	Process	Response to wounding	ISS
GO:0010494	Component	Cytoplasmic stress granule	IDA	15014438, 21964062
GO:0010837	Process	Regulation of keratinocyte proliferation	IMP	27182009
GO:0019899	Function	Enzyme binding	IPI	25038453
GO:0019901	Function	Protein kinase binding	IPI	15014438
GO:0019957	Function	C-C chemokine binding	IPI	21784977
GO:0030014	Component	CCR4-NOT complex	ISS
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IEA
GO:0031072	Function	Heat shock protein binding	IDA	20221403
GO:0031086	Process	Nuclear-transcribed mRNA catabolic process, deadenylation-independent decay	IDA	11279239
GO:0032680	Process	Regulation of tumor necrosis factor production	IDA	15014438
GO:0032703	Process	Negative regulation of interleukin-2 production	ISS
GO:0032897	Process	Negative regulation of viral transcription	IMP	14679154
GO:0035278	Process	MiRNA-mediated gene silencing by inhibition of translation	ISS
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	IDA	9703499, 10330172, 12748283, 15014438, 15187101, 15634918, 15766526, 20221403, 20702587, 25038453
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	IMP	21784977
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	TAS	9703499
GO:0038066	Process	P38MAPK cascade	ISS
GO:0042594	Process	Response to starvation	IDA	15014438
GO:0043488	Process	Regulation of mRNA stability	IDA	9703499, 11719186, 15687258, 20702587
GO:0043488	Process	Regulation of mRNA stability	IMP	15187101, 15634918
GO:0044344	Process	Cellular response to fibroblast growth factor stimulus	IDA	20166898
GO:0044877	Function	Protein-containing complex binding	IPI	16364915
GO:0045600	Process	Positive regulation of fat cell differentiation	ISS
GO:0045616	Process	Regulation of keratinocyte differentiation	IMP	27182009
GO:0045647	Process	Negative regulation of erythrocyte differentiation	IDA	20702587
GO:0046872	Function	Metal ion binding	IEA
GO:0051028	Process	MRNA transport	IEA
GO:0051028	Process	MRNA transport	IMP	17369404
GO:0060213	Process	Positive regulation of nuclear-transcribed mRNA poly(A) tail shortening	IDA	10330172
GO:0061158	Process	3'-UTR-mediated mRNA destabilization	IDA	9703499, 11719186, 15687258, 20221403, 27193233
GO:0061158	Process	3'-UTR-mediated mRNA destabilization	IEA
GO:0061158	Process	3'-UTR-mediated mRNA destabilization	IMP	14679154, 15187101, 15634918, 15766526
GO:0070063	Function	RNA polymerase binding	ISS
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	IDA	15014438
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	14766228
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	14679154, 15187101
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	20166898
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IDA	20166898
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0071385	Process	Cellular response to glucocorticoid stimulus	IDA	20166898
GO:0071385	Process	Cellular response to glucocorticoid stimulus	IEA
GO:0071889	Function	14-3-3 protein binding	IDA	15014438
GO:0097011	Process	Cellular response to granulocyte macrophage colony-stimulating factor stimulus	IDA	20166898
GO:0160134	Function	Protein-RNA sequence-specific adaptor activity	IDA	12748283
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IDA	21606497
GO:1900153	Process	Positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	12748283
GO:1900153	Process	Positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	ISS
GO:1901835	Process	Positive regulation of deadenylation-independent decapping of nuclear-transcribed mRNA	IDA	16364915
GO:1902172	Process	Regulation of keratinocyte apoptotic process	IMP	27182009
GO:1904246	Process	Negative regulation of polynucleotide adenylyltransferase activity	ISS
GO:1904582	Process	Positive regulation of intracellular mRNA localization	IMP	17369404
GO:1905869	Process	Negative regulation of 3'-UTR-mediated mRNA stabilization	IDA	21606497
GO:1990904	Component	Ribonucleoprotein complex	IDA	10330172, 15687258, 20702587
GO:1990904	Component	Ribonucleoprotein complex	IEA
GO:2000637	Process	Positive regulation of miRNA-mediated gene silencing	IMP	15766526

Other IDs

• MIM: 190700
• HGNC: 12862
• e!Ensembl: ENSG00000128016

Protein

• UniProt ID: P26651
• Protein name: mRNA decay activator protein ZFP36 (G0/G1 switch regulatory protein 24) (Growth factor-inducible nuclear protein NUP475) (Tristetraprolin) (Zinc finger protein 36) (Zfp-36)
• Protein function: Zinc-finger RNA-binding protein that destabilizes several cytoplasmic AU-rich element (ARE)-containing mRNA transcripts by promoting their poly(A) tail removal or deadenylation, and hence provide a mechanism for attenuating protein synthesis (Pu
• PDB: 4J8S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00642	zf-CCCH	104 → 130	Zinc finger C-x8-C-x5-C-x3-H type (and similar)	Family
  PF00642	zf-CCCH	142 → 168	Zinc finger C-x8-C-x5-C-x3-H type (and similar)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in both basal and suprabasal epidermal layers (PubMed:27182009). Expressed in epidermal keratinocytes (PubMed:27182009). Expressed strongly in mature dendritic cells (PubMed:18367721). Expressed in immature dendritic cells (a
• Sequence:

  MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTS
  LVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRY
  GAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPV
  LRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPL
  ARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFE
  AGVFAPPQPVAAPRRLPIFNRISVSE

• Sequence length: 326

Pathways

KEGG:

Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection

Reactome:

Tristetraprolin (TTP, ZFP36) binds and destabilizes mRNA

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CACHEXIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPLASIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	7506373		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25541715, 29577897		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19697322		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	27840917		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	CTD_human_DG	15944294		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	CTD_human_DG	15944294		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37933012	Associate	★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	CTD_human_DG	15944294		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21784977, 23564081		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	15535838, 16546352, 21784977, 27503556, 27597652, 28570274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	CTD_human_DG	15944294		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	Pubtator	16262601	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17599736	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30852628		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	29043400		★☆☆☆☆ Found in Text Mining only
Ataxia with vitamin E deficiency	Friedreich Ataxia	BEFREE	16819822, 20464573, 23077608		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	16614304	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21784977, 23564081		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	12754205, 16262601, 31817224	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	14727261, 15535838, 16546352, 22491258, 29848443		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	22995314		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	38212812	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19247375, 19491267, 20498646, 21875902, 22907529, 22968621, 23241166, 23401122, 24737323, 25541715, 26926077, 26956973, 27197193, 29570932, 29725473		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19491267, 25541715	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22907529, 25501155, 26926077, 26956973, 35037412, 38111129	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19208339, 20157568, 22210895, 23595149	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22968621		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	32784485	Inhibit	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	31817224		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	31817224	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	35962388	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29877679		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	26343742		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19050308, 28504646		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30852628		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	24103357		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28607633		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19697322		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	19208339		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36246978	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26343742, 27463018		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21507959, 23880304, 26343742, 32784606	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27463018	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital Thrombotic Thrombocytopenic Purpura	Congenital Thrombotic Thrombocytopenic Purpura	BEFREE	22907529		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	19363120, 20952496, 23524258		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19363120, 20952496	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	15170914, 30622281		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	16820934		★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	24103357		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	CTD_human_DG	15944294		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis	Dermatitis	BEFREE	23997224		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	17893259, 26517838, 29997282		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17893259, 26517838, 29997282		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26517838	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	26517838		★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic Ketoacidosis	BEFREE	31652001		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	26517838, 36466094, 37396184, 37988198	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	26517838		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	10331507, 26410136		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	28724967		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	36232817	Associate	★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	27840917		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29509432		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30226813		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	30103756	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22544323, 23898108, 29043400		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22544323, 25939870	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22544323, 23898108		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23525947, 25939870, 26537190	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25556371, 26537190, 26654773, 27424080, 29535596		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	38278877	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	27840917		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	18814951	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	24780075	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	23349315, 25604244		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	21917750	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	10331507, 3389894		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	38212812	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	35037412	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytoid hemangioma	Epithelioid hemangioma	BEFREE	25043949, 26135557		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	30637573		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	16262601	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	35538543	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	31952466	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	24103357		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31660029		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31660029	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	37741987	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	26517838		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	26517838	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10831918, 7506373		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26542173	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20038433, 27619201, 30300039, 31717307		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27074834	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	21917750, 25541715	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	22863009, 25541715		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	18245466, 23525947, 26537190		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	23349315, 25604244		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	24697202		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19247375, 19491267, 20498646, 21875902, 22907529, 22968621, 23241166, 23401122, 24737323, 25541715, 26926077, 26956973, 27197193, 29570932, 29725473		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	20038433, 30535453		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26356262, 26894969		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27078000, 27825143, 30108099, 30420441		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29728635, 29936792		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10831918, 14727261, 20157568, 21656745, 22201737, 22387927, 22863009, 22968621, 23401122, 25541715, 26486958, 26926077, 27197193, 27644249, 27825143, 28356023, 29124478, 29570932, 29848443, 29936792, 29956753, 30311568, 30380668, 31717307		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19697322		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	11588035, 15535838, 31036567		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26497679		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21593445		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	17546847, 21329350		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	30195796		★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse	Mitral valve prolapse	Pubtator	37180137	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	35861833	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis	Myositis	BEFREE	22194858		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	25541715	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17855506, 19491267, 19639174, 20157568, 20335167, 21875902, 22700982, 22863009, 22968621, 23241166, 23583445, 24697202, 24737323, 25541715, 26356262, 26497679, 26840564, 26894969, 27424080, 27463018, 27825143, 27911268, 29246442, 29577897, 29723192, 29936792, 29953478, 30108099, 30380668, 30420441, 31141941, 31717307		★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	24103357		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30535453		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17546847		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37741987	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	39639239	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	18682699, 28206953		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	39809219	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26356262, 26894969		★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	30347604		★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	BEFREE	15535838		★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	CTD_human_DG	15944294		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	8545129		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27078000, 27825143, 30108099, 30420441		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15067324		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24150491, 27078000, 30108099, 35538543	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25541715, 30420441	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	27825143		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	26517838	Inhibit	★☆☆☆☆ Found in Text Mining only
Pseudopelade	Pseudopelade	CTD_human_DG	15944294		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28570274		★☆☆☆☆ Found in Text Mining only
Pulmonary Cystic Fibrosis	Pulmonary Cystic Fibrosis	BEFREE	19363120		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30349226	Associate	★☆☆☆☆ Found in Text Mining only
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	22907529, 3389894		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	30852628		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	33397444	Associate	★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	30108099		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15170914, 15535838, 15940758, 16546352, 16820934, 18536977, 21611196, 27597652, 30029685, 30639474		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15170914, 16596264, 16820934		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	36476595	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31652001		★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	24103357		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	26125882	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	26125882		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	26125882		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21656745, 24085785	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	21656745, 23349315, 24085785, 24568968, 25604244		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29509432		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29728635, 29936792		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27074834	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29728635, 29936792, 36221394	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29535596		★☆☆☆☆ Found in Text Mining only
Thrombotic Microangiopathies	Thrombotic Microangiopathies	BEFREE	26410136		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	24780075		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	11588035		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	20157568	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Neoplasms	Vascular neoplasm	BEFREE	31553804		★☆☆☆☆ Found in Text Mining only