Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	753
Gene name	Low density lipoprotein receptor class A domain containing 4
Gene symbol	LDLRAD4
Synonyms (NCBI Gene)	C18orf1
Chromosome	18
Chromosome location	18p11.21

Show/Hide all (82)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017628	hsa-miR-335-5p	Microarray	18185580
MIRT022560	hsa-miR-124-3p	Microarray	18668037
MIRT721404	hsa-miR-6510-5p	HITS-CLIP	19536157
MIRT721403	hsa-miR-7160-3p	HITS-CLIP	19536157
MIRT721402	hsa-miR-2114-5p	HITS-CLIP	19536157
MIRT721401	hsa-miR-214-3p	HITS-CLIP	19536157
MIRT721400	hsa-miR-3619-5p	HITS-CLIP	19536157
MIRT721399	hsa-miR-761	HITS-CLIP	19536157
MIRT721398	hsa-miR-3918	HITS-CLIP	19536157
MIRT721397	hsa-miR-4530	HITS-CLIP	19536157
MIRT721396	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT721395	hsa-miR-4722-3p	HITS-CLIP	19536157
MIRT721394	hsa-miR-6727-3p	HITS-CLIP	19536157
MIRT721393	hsa-miR-6132	HITS-CLIP	19536157
MIRT721392	hsa-miR-6836-5p	HITS-CLIP	19536157
MIRT721391	hsa-miR-3194-5p	HITS-CLIP	19536157
MIRT721390	hsa-miR-1202	HITS-CLIP	19536157
MIRT721389	hsa-miR-3972	HITS-CLIP	19536157
MIRT709301	hsa-miR-3183	HITS-CLIP	19536157
MIRT709300	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT709299	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT709298	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT709297	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT709296	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT709295	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT709294	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT387445	hsa-miR-3658	HITS-CLIP	19536157
MIRT709293	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT709292	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT709291	hsa-miR-7856-5p	HITS-CLIP	19536157
MIRT709301	hsa-miR-3183	HITS-CLIP	19536157
MIRT709300	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT709299	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT709298	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT709297	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT709296	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT709295	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT709294	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT387445	hsa-miR-3658	HITS-CLIP	19536157
MIRT709293	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT709292	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT709291	hsa-miR-7856-5p	HITS-CLIP	19536157
MIRT721404	hsa-miR-6510-5p	HITS-CLIP	19536157
MIRT721403	hsa-miR-7160-3p	HITS-CLIP	19536157
MIRT721402	hsa-miR-2114-5p	HITS-CLIP	19536157
MIRT721401	hsa-miR-214-3p	HITS-CLIP	19536157
MIRT721400	hsa-miR-3619-5p	HITS-CLIP	19536157
MIRT721399	hsa-miR-761	HITS-CLIP	19536157
MIRT721398	hsa-miR-3918	HITS-CLIP	19536157
MIRT721397	hsa-miR-4530	HITS-CLIP	19536157
MIRT721396	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT721395	hsa-miR-4722-3p	HITS-CLIP	19536157
MIRT721394	hsa-miR-6727-3p	HITS-CLIP	19536157
MIRT721393	hsa-miR-6132	HITS-CLIP	19536157
MIRT721392	hsa-miR-6836-5p	HITS-CLIP	19536157
MIRT721391	hsa-miR-3194-5p	HITS-CLIP	19536157
MIRT721390	hsa-miR-1202	HITS-CLIP	19536157
MIRT721389	hsa-miR-3972	HITS-CLIP	19536157
MIRT709301	hsa-miR-3183	HITS-CLIP	19536157
MIRT709300	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT709299	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT709298	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT709297	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT709296	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT709295	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT709294	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT387445	hsa-miR-3658	HITS-CLIP	19536157
MIRT709293	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT709292	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT709291	hsa-miR-7856-5p	HITS-CLIP	19536157
MIRT709301	hsa-miR-3183	HITS-CLIP	19536157
MIRT709300	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT709299	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT709298	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT709297	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT709296	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT709295	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT709294	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT387445	hsa-miR-3658	HITS-CLIP	19536157
MIRT709293	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT709292	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT709291	hsa-miR-7856-5p	HITS-CLIP	19536157

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IBA
GO:0005515	Function	Protein binding	IPI	24627487, 32296183, 33961781, 35044719
GO:0005768	Component	Endosome	IEA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IMP	24627487
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	9479497
GO:0030336	Process	Negative regulation of cell migration	IMP	24627487
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IBA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IDA	24627487
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IMP	24627487
GO:0031901	Component	Early endosome membrane	IBA
GO:0031901	Component	Early endosome membrane	IDA	24627487
GO:0031901	Component	Early endosome membrane	IEA
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IDA	24627487
GO:0070412	Function	R-SMAD binding	IBA
GO:0070412	Function	R-SMAD binding	IEA
GO:0070412	Function	R-SMAD binding	IPI	24627487

MIM	HGNC	e!Ensembl
606571	1224	ENSG00000168675

O15165

Protein name

Low-density lipoprotein receptor class A domain-containing protein 4

Protein function

Functions as a negative regulator of TGF-beta signaling and thereby probably plays a role in cell proliferation, differentiation, apoptosis, motility, extracellular matrix production and immunosuppression. In the canonical TGF-beta pathway, ZFYV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00057	Ldl_recept_a	13 → 47	Low-density lipoprotein receptor domain class A	Repeat

Tissue specificity

TISSUE SPECIFICITY: Expressed in lymphocytes. {ECO:0000269|PubMed:19461657}.

Sequence

MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFN
SELEFAQIIIIVVVVTVMVVVIVCLLNHYKVSTRSFINRPNQSRRREDGLPQEGCLWPSD
SAAPRLGASEIMHAPRSRDRFTAPSFIQRDRFSRFQPTYPYVQHEIDLPPTISLSDGEEP
PPYQGPCTLQLRDPEQQMELNRESVRAPPNRTIFDSDLIDIAMYSGGPCPPSSNSGISAS
TCSSNGRMEGPPPTYSEVMGHHPGASFLHHQRSNAHRGSRLQFQQNNAESTIVPIKGKDR
KPGNLV

Sequence length

306

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (31)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOROIDAL MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32111819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	32590150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	32507364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant melanoma of choroid	Choroidal melanoma	GWASCAT_DG	31626034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28888937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	GWASDB_DG	23180869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27573352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28888937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30547318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	GWASCAT_DG	23180869, 28470677		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23180869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	30547318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	10879745	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

LDLRAD4 (low density lipoprotein receptor class A domain containing 4)