YY1 (YY1 transcription factor)

Gene

• Entrez ID: 7528
• Gene name: YY1 transcription factor
• Gene symbol: YY1
• Synonyms (NCBI Gene): DELTA, GADEVS, INO80S, NF-E1, UCRBP, YIN-YANG-1
• Chromosome: 14
• Chromosome location: 14q32.2
• Summary: YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetylt

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1131692046	A>T	Pathogenic	Coding sequence variant, stop gained
rs1555368900	AG>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1555370811	TTAAA>-	Pathogenic	Coding sequence variant, frameshift variant
rs1595309671	G>-	Pathogenic	Frameshift variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004968	hsa-miR-31-5p	Luciferase reporter assay, qRT-PCR	19524507
MIRT004045	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	21182263
MIRT004045	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	21182263
MIRT004045	hsa-miR-34a-5p	Reporter assay	21182263
MIRT004045	hsa-miR-34a-5p	Reporter assay;Proteomics	21566225
MIRT028073	hsa-miR-93-5p	Sequencing	20371350
MIRT028073	hsa-miR-93-5p	CLASH	23622248
MIRT046848	hsa-miR-221-3p	CLASH	23622248
MIRT043278	hsa-miR-331-3p	CLASH	23622248
MIRT041821	hsa-miR-484	CLASH	23622248
MIRT040246	hsa-miR-615-3p	CLASH	23622248
MIRT039108	hsa-miR-769-3p	CLASH	23622248
MIRT053022	hsa-miR-7-5p	Luciferase reporter assay, Western blot	23208495
MIRT053022	hsa-miR-7-5p	Luciferase reporter assay, Western blot	23208495
MIRT053768	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	24763883
MIRT053768	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	24763883
MIRT004045	hsa-miR-34a-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24970812
MIRT054032	hsa-miR-34b-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24970812
MIRT054033	hsa-miR-34c-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24970812
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT639853	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT639854	hsa-miR-1323	HITS-CLIP	23824327
MIRT639852	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT639851	hsa-miR-3155a	HITS-CLIP	23824327
MIRT639850	hsa-miR-3155b	HITS-CLIP	23824327
MIRT041821	hsa-miR-484	HITS-CLIP	23824327
MIRT639849	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT621587	hsa-miR-6840-5p	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT621586	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT574380	hsa-miR-219a-2-3p	PAR-CLIP	20371350
MIRT574379	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT574378	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT574377	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT574376	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT574375	hsa-miR-3133	PAR-CLIP	20371350
MIRT463639	hsa-miR-1208	PAR-CLIP	20371350
MIRT574374	hsa-miR-6830-3p	PAR-CLIP	20371350
MIRT574373	hsa-miR-3613-5p	PAR-CLIP	20371350
MIRT564874	hsa-miR-585-5p	PAR-CLIP	20371350
MIRT564873	hsa-miR-5682	PAR-CLIP	20371350
MIRT574372	hsa-miR-511-5p	PAR-CLIP	20371350
MIRT561354	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT561353	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT561352	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT561351	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT561350	hsa-miR-6793-3p	PAR-CLIP	20371350
MIRT561349	hsa-miR-3177-5p	PAR-CLIP	20371350
MIRT561348	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT564875	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT520010	hsa-miR-8066	PAR-CLIP	20371350
MIRT520009	hsa-miR-5588-3p	PAR-CLIP	20371350
MIRT520008	hsa-miR-1279	PAR-CLIP	20371350
MIRT564874	hsa-miR-585-5p	PAR-CLIP	20371350
MIRT564873	hsa-miR-5682	PAR-CLIP	20371350
MIRT520006	hsa-miR-5007-3p	PAR-CLIP	20371350
MIRT564872	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT561354	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT561353	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT561352	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT561351	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT561350	hsa-miR-6793-3p	PAR-CLIP	20371350
MIRT561349	hsa-miR-3177-5p	PAR-CLIP	20371350
MIRT561348	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT463651	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT463650	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT463649	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT463648	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT463647	hsa-miR-4295	PAR-CLIP	20371350
MIRT463646	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT463645	hsa-miR-3666	PAR-CLIP	20371350
MIRT463644	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT463643	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT463642	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT463641	hsa-miR-4496	PAR-CLIP	20371350
MIRT463638	hsa-miR-1909-5p	PAR-CLIP	20371350
MIRT463637	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT463636	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT463635	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT463634	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT463632	hsa-miR-1238-5p	PAR-CLIP	20371350
MIRT463631	hsa-miR-4758-5p	PAR-CLIP	20371350
MIRT463630	hsa-miR-4658	PAR-CLIP	20371350
MIRT463629	hsa-miR-6790-5p	PAR-CLIP	20371350
MIRT463628	hsa-miR-548aw	PAR-CLIP	20371350
MIRT561354	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT561353	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT561352	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT561351	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT561350	hsa-miR-6793-3p	PAR-CLIP	20371350
MIRT561349	hsa-miR-3177-5p	PAR-CLIP	20371350
MIRT561348	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT463651	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT463650	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT463649	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT463648	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT463647	hsa-miR-4295	PAR-CLIP	20371350
MIRT463646	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT463645	hsa-miR-3666	PAR-CLIP	20371350
MIRT463644	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT463643	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT463642	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT463641	hsa-miR-4496	PAR-CLIP	20371350
MIRT463638	hsa-miR-1909-5p	PAR-CLIP	20371350
MIRT463637	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT463636	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT463635	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT463634	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT463633	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT463632	hsa-miR-1238-5p	PAR-CLIP	20371350
MIRT463631	hsa-miR-4758-5p	PAR-CLIP	20371350
MIRT463630	hsa-miR-4658	PAR-CLIP	20371350
MIRT463629	hsa-miR-6790-5p	PAR-CLIP	20371350
MIRT463628	hsa-miR-548aw	PAR-CLIP	20371350
MIRT552677	hsa-miR-4789-3p	PAR-CLIP	20371350
MIRT552676	hsa-miR-4643	PAR-CLIP	20371350
MIRT552675	hsa-miR-3976	PAR-CLIP	20371350
MIRT552674	hsa-miR-586	PAR-CLIP	20371350
MIRT552673	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT552671	hsa-miR-4729	PAR-CLIP	20371350
MIRT552672	hsa-miR-3941	PAR-CLIP	20371350
MIRT552670	hsa-miR-4672	PAR-CLIP	20371350
MIRT552669	hsa-miR-466	PAR-CLIP	20371350
MIRT552668	hsa-miR-4795-3p	PAR-CLIP	20371350
MIRT552667	hsa-miR-568	PAR-CLIP	20371350
MIRT552666	hsa-miR-491-3p	PAR-CLIP	20371350
MIRT552680	hsa-miR-219a-1-3p	PAR-CLIP	21572407
MIRT463651	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT463650	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT463649	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT463648	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT463647	hsa-miR-4295	PAR-CLIP	21572407
MIRT463646	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT463645	hsa-miR-3666	PAR-CLIP	21572407
MIRT463644	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT463643	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT463642	hsa-miR-651-3p	PAR-CLIP	21572407
MIRT054032	hsa-miR-34b-3p	PAR-CLIP	21572407
MIRT463641	hsa-miR-4496	PAR-CLIP	21572407
MIRT463640	hsa-miR-6760-3p	PAR-CLIP	21572407
MIRT463638	hsa-miR-1909-5p	PAR-CLIP	21572407
MIRT552679	hsa-miR-571	PAR-CLIP	21572407
MIRT463637	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT463636	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT463635	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT463634	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT463633	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT463632	hsa-miR-1238-5p	PAR-CLIP	21572407
MIRT463631	hsa-miR-4758-5p	PAR-CLIP	21572407
MIRT463630	hsa-miR-4658	PAR-CLIP	21572407
MIRT463629	hsa-miR-6790-5p	PAR-CLIP	21572407
MIRT463628	hsa-miR-548aw	PAR-CLIP	21572407
MIRT552678	hsa-miR-543	PAR-CLIP	21572407
MIRT552677	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT552676	hsa-miR-4643	PAR-CLIP	21572407
MIRT552675	hsa-miR-3976	PAR-CLIP	21572407
MIRT552674	hsa-miR-586	PAR-CLIP	21572407
MIRT552673	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT552671	hsa-miR-4729	PAR-CLIP	21572407
MIRT552672	hsa-miR-3941	PAR-CLIP	21572407
MIRT552670	hsa-miR-4672	PAR-CLIP	21572407
MIRT552669	hsa-miR-466	PAR-CLIP	21572407
MIRT552668	hsa-miR-4795-3p	PAR-CLIP	21572407
MIRT552667	hsa-miR-568	PAR-CLIP	21572407
MIRT552666	hsa-miR-491-3p	PAR-CLIP	21572407
MIRT463651	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT463650	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT463649	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT463648	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT463647	hsa-miR-4295	PAR-CLIP	21572407
MIRT463646	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT463645	hsa-miR-3666	PAR-CLIP	21572407
MIRT463644	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT463643	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT463642	hsa-miR-651-3p	PAR-CLIP	21572407
MIRT054032	hsa-miR-34b-3p	PAR-CLIP	21572407
MIRT463641	hsa-miR-4496	PAR-CLIP	21572407
MIRT463640	hsa-miR-6760-3p	PAR-CLIP	21572407
MIRT463638	hsa-miR-1909-5p	PAR-CLIP	21572407
MIRT463637	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT463636	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT463635	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT463634	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT463633	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT463632	hsa-miR-1238-5p	PAR-CLIP	21572407
MIRT463631	hsa-miR-4758-5p	PAR-CLIP	21572407
MIRT463630	hsa-miR-4658	PAR-CLIP	21572407
MIRT463629	hsa-miR-6790-5p	PAR-CLIP	21572407
MIRT463628	hsa-miR-548aw	PAR-CLIP	21572407
MIRT533070	hsa-miR-193a-3p	PAR-CLIP	22012620
MIRT533069	hsa-miR-193b-3p	PAR-CLIP	22012620
MIRT533068	hsa-miR-892b	PAR-CLIP	22012620
MIRT533067	hsa-miR-183-5p	PAR-CLIP	22012620
MIRT520010	hsa-miR-8066	PAR-CLIP	23446348
MIRT520009	hsa-miR-5588-3p	PAR-CLIP	23446348
MIRT520008	hsa-miR-1279	PAR-CLIP	23446348
MIRT520007	hsa-miR-27b-5p	PAR-CLIP	23446348
MIRT520006	hsa-miR-5007-3p	PAR-CLIP	23446348
MIRT463651	hsa-miR-19b-3p	PAR-CLIP	23446348
MIRT463650	hsa-miR-19a-3p	PAR-CLIP	23446348
MIRT463649	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT463648	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT463647	hsa-miR-4295	PAR-CLIP	23446348
MIRT463646	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT463645	hsa-miR-3666	PAR-CLIP	23446348
MIRT463644	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT463643	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT463642	hsa-miR-651-3p	PAR-CLIP	23446348
MIRT054032	hsa-miR-34b-3p	PAR-CLIP	23446348
MIRT463641	hsa-miR-4496	PAR-CLIP	23446348
MIRT463640	hsa-miR-6760-3p	PAR-CLIP	23446348
MIRT463638	hsa-miR-1909-5p	PAR-CLIP	23446348
MIRT463637	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT463636	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT463635	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT463634	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT463633	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT463632	hsa-miR-1238-5p	PAR-CLIP	23446348
MIRT463631	hsa-miR-4758-5p	PAR-CLIP	23446348
MIRT463630	hsa-miR-4658	PAR-CLIP	23446348
MIRT463629	hsa-miR-6790-5p	PAR-CLIP	23446348
MIRT463628	hsa-miR-548aw	PAR-CLIP	23446348
MIRT463651	hsa-miR-19b-3p	PAR-CLIP	23446348
MIRT463650	hsa-miR-19a-3p	PAR-CLIP	23446348
MIRT463649	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT463648	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT463647	hsa-miR-4295	PAR-CLIP	23446348
MIRT463646	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT463645	hsa-miR-3666	PAR-CLIP	23446348
MIRT463644	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT463643	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT463642	hsa-miR-651-3p	PAR-CLIP	23446348
MIRT054032	hsa-miR-34b-3p	PAR-CLIP	23446348
MIRT463641	hsa-miR-4496	PAR-CLIP	23446348
MIRT463640	hsa-miR-6760-3p	PAR-CLIP	23446348
MIRT463638	hsa-miR-1909-5p	PAR-CLIP	23446348
MIRT463637	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT463636	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT463635	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT463634	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT463633	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT463632	hsa-miR-1238-5p	PAR-CLIP	23446348
MIRT463631	hsa-miR-4758-5p	PAR-CLIP	23446348
MIRT463630	hsa-miR-4658	PAR-CLIP	23446348
MIRT463629	hsa-miR-6790-5p	PAR-CLIP	23446348
MIRT463628	hsa-miR-548aw	PAR-CLIP	23446348
MIRT463651	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT463650	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT463649	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT463648	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT463647	hsa-miR-4295	PAR-CLIP	23592263
MIRT463646	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT463645	hsa-miR-3666	PAR-CLIP	23592263
MIRT463644	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT463643	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT463642	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT054032	hsa-miR-34b-3p	PAR-CLIP	23592263
MIRT463641	hsa-miR-4496	PAR-CLIP	23592263
MIRT463640	hsa-miR-6760-3p	PAR-CLIP	23592263
MIRT463639	hsa-miR-1208	PAR-CLIP	23592263
MIRT463638	hsa-miR-1909-5p	PAR-CLIP	23592263
MIRT463637	hsa-miR-548aj-5p	PAR-CLIP	23592263
MIRT463636	hsa-miR-548f-5p	PAR-CLIP	23592263
MIRT463635	hsa-miR-548g-5p	PAR-CLIP	23592263
MIRT463634	hsa-miR-548x-5p	PAR-CLIP	23592263
MIRT463633	hsa-miR-1468-3p	PAR-CLIP	23592263
MIRT463632	hsa-miR-1238-5p	PAR-CLIP	23592263
MIRT463631	hsa-miR-4758-5p	PAR-CLIP	23592263
MIRT463630	hsa-miR-4658	PAR-CLIP	23592263
MIRT463629	hsa-miR-6790-5p	PAR-CLIP	23592263
MIRT463628	hsa-miR-548aw	PAR-CLIP	23592263
MIRT463651	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT463650	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT463649	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT463648	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT463647	hsa-miR-4295	PAR-CLIP	23592263
MIRT463646	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT463645	hsa-miR-3666	PAR-CLIP	23592263
MIRT463644	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT463643	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT463642	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT054032	hsa-miR-34b-3p	PAR-CLIP	23592263
MIRT463641	hsa-miR-4496	PAR-CLIP	23592263
MIRT463640	hsa-miR-6760-3p	PAR-CLIP	23592263
MIRT463639	hsa-miR-1208	PAR-CLIP	23592263
MIRT463638	hsa-miR-1909-5p	PAR-CLIP	23592263
MIRT463637	hsa-miR-548aj-5p	PAR-CLIP	23592263
MIRT463636	hsa-miR-548f-5p	PAR-CLIP	23592263
MIRT463635	hsa-miR-548g-5p	PAR-CLIP	23592263
MIRT463634	hsa-miR-548x-5p	PAR-CLIP	23592263
MIRT463633	hsa-miR-1468-3p	PAR-CLIP	23592263
MIRT463632	hsa-miR-1238-5p	PAR-CLIP	23592263
MIRT463631	hsa-miR-4758-5p	PAR-CLIP	23592263
MIRT463630	hsa-miR-4658	PAR-CLIP	23592263
MIRT463629	hsa-miR-6790-5p	PAR-CLIP	23592263
MIRT463628	hsa-miR-548aw	PAR-CLIP	23592263
MIRT463627	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT463626	hsa-miR-4532	PAR-CLIP	23592263
MIRT463625	hsa-miR-4722-3p	PAR-CLIP	23592263
MIRT463623	hsa-miR-6727-3p	PAR-CLIP	23592263
MIRT463624	hsa-miR-6747-3p	PAR-CLIP	23592263
MIRT463622	hsa-miR-3653-5p	PAR-CLIP	23592263
MIRT463621	hsa-miR-1976	PAR-CLIP	23592263
MIRT463620	hsa-miR-4279	PAR-CLIP	23592263
MIRT004045	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	25954903
MIRT552671	hsa-miR-4729	PAR-CLIP	27292025
MIRT463627	hsa-miR-1247-3p	HITS-CLIP	27418678
MIRT463621	hsa-miR-1976	HITS-CLIP	27418678
MIRT463622	hsa-miR-3653-5p	HITS-CLIP	27418678
MIRT463620	hsa-miR-4279	HITS-CLIP	27418678
MIRT463626	hsa-miR-4532	HITS-CLIP	27418678
MIRT463625	hsa-miR-4722-3p	HITS-CLIP	27418678
MIRT463623	hsa-miR-6727-3p	HITS-CLIP	27418678
MIRT463624	hsa-miR-6747-3p	HITS-CLIP	27418678
MIRT733644	hsa-miR-29a-3p	ELISA, Immunofluorescence, Immunoprecipitaion (IP), qRT-PCR, Western blotting	34061599
MIRT734997	hsa-miR-384	Western blotting, qRT-PCR	33061445
MIRT734998	hsa-miR-134-5p	Western blotting, qRT-PCR	33061445
MIRT735097	hsa-miR-302b-3p	Western blotting, qRT-PCR	32806777
MIRT736987	hsa-miR-1-3p	RNA-seq	32153636
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT639853	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT639854	hsa-miR-1323	HITS-CLIP	23824327
MIRT639852	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT639851	hsa-miR-3155a	HITS-CLIP	23824327
MIRT639850	hsa-miR-3155b	HITS-CLIP	23824327
MIRT041821	hsa-miR-484	HITS-CLIP	23824327
MIRT639849	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT621587	hsa-miR-6840-5p	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT621586	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT612305	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT612304	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT612303	hsa-miR-4522	HITS-CLIP	23824327
MIRT574380	hsa-miR-219a-2-3p	PAR-CLIP	20371350
MIRT574379	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT574378	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT574377	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT574376	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT574375	hsa-miR-3133	PAR-CLIP	20371350
MIRT463639	hsa-miR-1208	PAR-CLIP	20371350
MIRT574374	hsa-miR-6830-3p	PAR-CLIP	20371350
MIRT574373	hsa-miR-3613-5p	PAR-CLIP	20371350
MIRT564874	hsa-miR-585-5p	PAR-CLIP	20371350
MIRT564873	hsa-miR-5682	PAR-CLIP	20371350
MIRT574372	hsa-miR-511-5p	PAR-CLIP	20371350
MIRT561354	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT561353	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT561352	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT561351	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT561350	hsa-miR-6793-3p	PAR-CLIP	20371350
MIRT561349	hsa-miR-3177-5p	PAR-CLIP	20371350
MIRT561348	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT564875	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT520010	hsa-miR-8066	PAR-CLIP	20371350
MIRT520009	hsa-miR-5588-3p	PAR-CLIP	20371350
MIRT520008	hsa-miR-1279	PAR-CLIP	20371350
MIRT564874	hsa-miR-585-5p	PAR-CLIP	20371350
MIRT564873	hsa-miR-5682	PAR-CLIP	20371350
MIRT520006	hsa-miR-5007-3p	PAR-CLIP	20371350
MIRT564872	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT561354	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT561353	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT561352	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT561351	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT561350	hsa-miR-6793-3p	PAR-CLIP	20371350
MIRT561349	hsa-miR-3177-5p	PAR-CLIP	20371350
MIRT561348	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT463651	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT463650	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT463649	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT463648	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT463647	hsa-miR-4295	PAR-CLIP	20371350
MIRT463646	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT463645	hsa-miR-3666	PAR-CLIP	20371350
MIRT463644	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT463643	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT463642	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT463641	hsa-miR-4496	PAR-CLIP	20371350
MIRT463638	hsa-miR-1909-5p	PAR-CLIP	20371350
MIRT463637	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT463636	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT463635	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT463634	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT463632	hsa-miR-1238-5p	PAR-CLIP	20371350
MIRT463631	hsa-miR-4758-5p	PAR-CLIP	20371350
MIRT463630	hsa-miR-4658	PAR-CLIP	20371350
MIRT463629	hsa-miR-6790-5p	PAR-CLIP	20371350
MIRT463628	hsa-miR-548aw	PAR-CLIP	20371350
MIRT561354	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT561353	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT561352	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT561351	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT561350	hsa-miR-6793-3p	PAR-CLIP	20371350
MIRT561349	hsa-miR-3177-5p	PAR-CLIP	20371350
MIRT561348	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT463651	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT463650	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT463649	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT463648	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT463647	hsa-miR-4295	PAR-CLIP	20371350
MIRT463646	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT463645	hsa-miR-3666	PAR-CLIP	20371350
MIRT463644	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT463643	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT463642	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT463641	hsa-miR-4496	PAR-CLIP	20371350
MIRT463638	hsa-miR-1909-5p	PAR-CLIP	20371350
MIRT463637	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT463636	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT463635	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT463634	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT463633	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT463632	hsa-miR-1238-5p	PAR-CLIP	20371350
MIRT463631	hsa-miR-4758-5p	PAR-CLIP	20371350
MIRT463630	hsa-miR-4658	PAR-CLIP	20371350
MIRT463629	hsa-miR-6790-5p	PAR-CLIP	20371350
MIRT463628	hsa-miR-548aw	PAR-CLIP	20371350
MIRT552677	hsa-miR-4789-3p	PAR-CLIP	20371350
MIRT552676	hsa-miR-4643	PAR-CLIP	20371350
MIRT552675	hsa-miR-3976	PAR-CLIP	20371350
MIRT552674	hsa-miR-586	PAR-CLIP	20371350
MIRT552673	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT552671	hsa-miR-4729	PAR-CLIP	20371350
MIRT552672	hsa-miR-3941	PAR-CLIP	20371350
MIRT552670	hsa-miR-4672	PAR-CLIP	20371350
MIRT552669	hsa-miR-466	PAR-CLIP	20371350
MIRT552668	hsa-miR-4795-3p	PAR-CLIP	20371350
MIRT552667	hsa-miR-568	PAR-CLIP	20371350
MIRT552666	hsa-miR-491-3p	PAR-CLIP	20371350
MIRT552680	hsa-miR-219a-1-3p	PAR-CLIP	21572407
MIRT463651	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT463650	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT463649	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT463648	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT463647	hsa-miR-4295	PAR-CLIP	21572407
MIRT463646	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT463645	hsa-miR-3666	PAR-CLIP	21572407
MIRT463644	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT463643	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT463642	hsa-miR-651-3p	PAR-CLIP	21572407
MIRT054032	hsa-miR-34b-3p	PAR-CLIP	21572407
MIRT463641	hsa-miR-4496	PAR-CLIP	21572407
MIRT463640	hsa-miR-6760-3p	PAR-CLIP	21572407
MIRT463638	hsa-miR-1909-5p	PAR-CLIP	21572407
MIRT552679	hsa-miR-571	PAR-CLIP	21572407
MIRT463637	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT463636	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT463635	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT463634	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT463633	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT463632	hsa-miR-1238-5p	PAR-CLIP	21572407
MIRT463631	hsa-miR-4758-5p	PAR-CLIP	21572407
MIRT463630	hsa-miR-4658	PAR-CLIP	21572407
MIRT463629	hsa-miR-6790-5p	PAR-CLIP	21572407
MIRT463628	hsa-miR-548aw	PAR-CLIP	21572407
MIRT552678	hsa-miR-543	PAR-CLIP	21572407
MIRT552677	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT552676	hsa-miR-4643	PAR-CLIP	21572407
MIRT552675	hsa-miR-3976	PAR-CLIP	21572407
MIRT552674	hsa-miR-586	PAR-CLIP	21572407
MIRT552673	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT552671	hsa-miR-4729	PAR-CLIP	21572407
MIRT552672	hsa-miR-3941	PAR-CLIP	21572407
MIRT552670	hsa-miR-4672	PAR-CLIP	21572407
MIRT552669	hsa-miR-466	PAR-CLIP	21572407
MIRT552668	hsa-miR-4795-3p	PAR-CLIP	21572407
MIRT552667	hsa-miR-568	PAR-CLIP	21572407
MIRT552666	hsa-miR-491-3p	PAR-CLIP	21572407
MIRT463651	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT463650	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT463649	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT463648	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT463647	hsa-miR-4295	PAR-CLIP	21572407
MIRT463646	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT463645	hsa-miR-3666	PAR-CLIP	21572407
MIRT463644	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT463643	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT463642	hsa-miR-651-3p	PAR-CLIP	21572407
MIRT054032	hsa-miR-34b-3p	PAR-CLIP	21572407
MIRT463641	hsa-miR-4496	PAR-CLIP	21572407
MIRT463640	hsa-miR-6760-3p	PAR-CLIP	21572407
MIRT463638	hsa-miR-1909-5p	PAR-CLIP	21572407
MIRT463637	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT463636	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT463635	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT463634	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT463633	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT463632	hsa-miR-1238-5p	PAR-CLIP	21572407
MIRT463631	hsa-miR-4758-5p	PAR-CLIP	21572407
MIRT463630	hsa-miR-4658	PAR-CLIP	21572407
MIRT463629	hsa-miR-6790-5p	PAR-CLIP	21572407
MIRT463628	hsa-miR-548aw	PAR-CLIP	21572407
MIRT533070	hsa-miR-193a-3p	PAR-CLIP	22012620
MIRT533069	hsa-miR-193b-3p	PAR-CLIP	22012620
MIRT533068	hsa-miR-892b	PAR-CLIP	22012620
MIRT533067	hsa-miR-183-5p	PAR-CLIP	22012620
MIRT520010	hsa-miR-8066	PAR-CLIP	23446348
MIRT520009	hsa-miR-5588-3p	PAR-CLIP	23446348
MIRT520008	hsa-miR-1279	PAR-CLIP	23446348
MIRT520007	hsa-miR-27b-5p	PAR-CLIP	23446348
MIRT520006	hsa-miR-5007-3p	PAR-CLIP	23446348
MIRT463651	hsa-miR-19b-3p	PAR-CLIP	23446348
MIRT463650	hsa-miR-19a-3p	PAR-CLIP	23446348
MIRT463649	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT463648	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT463647	hsa-miR-4295	PAR-CLIP	23446348
MIRT463646	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT463645	hsa-miR-3666	PAR-CLIP	23446348
MIRT463644	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT463643	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT463642	hsa-miR-651-3p	PAR-CLIP	23446348
MIRT054032	hsa-miR-34b-3p	PAR-CLIP	23446348
MIRT463641	hsa-miR-4496	PAR-CLIP	23446348
MIRT463640	hsa-miR-6760-3p	PAR-CLIP	23446348
MIRT463638	hsa-miR-1909-5p	PAR-CLIP	23446348
MIRT463637	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT463636	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT463635	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT463634	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT463633	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT463632	hsa-miR-1238-5p	PAR-CLIP	23446348
MIRT463631	hsa-miR-4758-5p	PAR-CLIP	23446348
MIRT463630	hsa-miR-4658	PAR-CLIP	23446348
MIRT463629	hsa-miR-6790-5p	PAR-CLIP	23446348
MIRT463628	hsa-miR-548aw	PAR-CLIP	23446348
MIRT463651	hsa-miR-19b-3p	PAR-CLIP	23446348
MIRT463650	hsa-miR-19a-3p	PAR-CLIP	23446348
MIRT463649	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT463648	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT463647	hsa-miR-4295	PAR-CLIP	23446348
MIRT463646	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT463645	hsa-miR-3666	PAR-CLIP	23446348
MIRT463644	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT463643	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT463642	hsa-miR-651-3p	PAR-CLIP	23446348
MIRT054032	hsa-miR-34b-3p	PAR-CLIP	23446348
MIRT463641	hsa-miR-4496	PAR-CLIP	23446348
MIRT463640	hsa-miR-6760-3p	PAR-CLIP	23446348
MIRT463638	hsa-miR-1909-5p	PAR-CLIP	23446348
MIRT463637	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT463636	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT463635	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT463634	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT463633	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT463632	hsa-miR-1238-5p	PAR-CLIP	23446348
MIRT463631	hsa-miR-4758-5p	PAR-CLIP	23446348
MIRT463630	hsa-miR-4658	PAR-CLIP	23446348
MIRT463629	hsa-miR-6790-5p	PAR-CLIP	23446348
MIRT463628	hsa-miR-548aw	PAR-CLIP	23446348
MIRT463651	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT463650	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT463649	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT463648	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT463647	hsa-miR-4295	PAR-CLIP	23592263
MIRT463646	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT463645	hsa-miR-3666	PAR-CLIP	23592263
MIRT463644	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT463643	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT463642	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT054032	hsa-miR-34b-3p	PAR-CLIP	23592263
MIRT463641	hsa-miR-4496	PAR-CLIP	23592263
MIRT463640	hsa-miR-6760-3p	PAR-CLIP	23592263
MIRT463639	hsa-miR-1208	PAR-CLIP	23592263
MIRT463638	hsa-miR-1909-5p	PAR-CLIP	23592263
MIRT463637	hsa-miR-548aj-5p	PAR-CLIP	23592263
MIRT463636	hsa-miR-548f-5p	PAR-CLIP	23592263
MIRT463635	hsa-miR-548g-5p	PAR-CLIP	23592263
MIRT463634	hsa-miR-548x-5p	PAR-CLIP	23592263
MIRT463633	hsa-miR-1468-3p	PAR-CLIP	23592263
MIRT463632	hsa-miR-1238-5p	PAR-CLIP	23592263
MIRT463631	hsa-miR-4758-5p	PAR-CLIP	23592263
MIRT463630	hsa-miR-4658	PAR-CLIP	23592263
MIRT463629	hsa-miR-6790-5p	PAR-CLIP	23592263
MIRT463628	hsa-miR-548aw	PAR-CLIP	23592263
MIRT463651	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT463650	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT463649	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT463648	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT463647	hsa-miR-4295	PAR-CLIP	23592263
MIRT463646	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT463645	hsa-miR-3666	PAR-CLIP	23592263
MIRT463644	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT463643	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT463642	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT054032	hsa-miR-34b-3p	PAR-CLIP	23592263
MIRT463641	hsa-miR-4496	PAR-CLIP	23592263
MIRT463640	hsa-miR-6760-3p	PAR-CLIP	23592263
MIRT463639	hsa-miR-1208	PAR-CLIP	23592263
MIRT463638	hsa-miR-1909-5p	PAR-CLIP	23592263
MIRT463637	hsa-miR-548aj-5p	PAR-CLIP	23592263
MIRT463636	hsa-miR-548f-5p	PAR-CLIP	23592263
MIRT463635	hsa-miR-548g-5p	PAR-CLIP	23592263
MIRT463634	hsa-miR-548x-5p	PAR-CLIP	23592263
MIRT463633	hsa-miR-1468-3p	PAR-CLIP	23592263
MIRT463632	hsa-miR-1238-5p	PAR-CLIP	23592263
MIRT463631	hsa-miR-4758-5p	PAR-CLIP	23592263
MIRT463630	hsa-miR-4658	PAR-CLIP	23592263
MIRT463629	hsa-miR-6790-5p	PAR-CLIP	23592263
MIRT463628	hsa-miR-548aw	PAR-CLIP	23592263
MIRT463627	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT463626	hsa-miR-4532	PAR-CLIP	23592263
MIRT463625	hsa-miR-4722-3p	PAR-CLIP	23592263
MIRT463623	hsa-miR-6727-3p	PAR-CLIP	23592263
MIRT463624	hsa-miR-6747-3p	PAR-CLIP	23592263
MIRT463622	hsa-miR-3653-5p	PAR-CLIP	23592263
MIRT463621	hsa-miR-1976	PAR-CLIP	23592263
MIRT463620	hsa-miR-4279	PAR-CLIP	23592263
MIRT755805	hsa-miR-192-3p	Luciferase reporter assay, Western blotting, qRT-PCR, RNA pull down assay	36914869
MIRT1501291	hsa-miR-1179	CLIP-seq
MIRT1501292	hsa-miR-1206	CLIP-seq
MIRT1501293	hsa-miR-125a-3p	CLIP-seq
MIRT1501294	hsa-miR-1283	CLIP-seq
MIRT1501295	hsa-miR-1302	CLIP-seq
MIRT1501296	hsa-miR-141	CLIP-seq
MIRT1501297	hsa-miR-181a	CLIP-seq
MIRT1501298	hsa-miR-181b	CLIP-seq
MIRT1501299	hsa-miR-181c	CLIP-seq
MIRT1501300	hsa-miR-181d	CLIP-seq
MIRT1501301	hsa-miR-186	CLIP-seq
MIRT1501302	hsa-miR-200a	CLIP-seq
MIRT1501303	hsa-miR-217	CLIP-seq
MIRT1501304	hsa-miR-219-2-3p	CLIP-seq
MIRT1501305	hsa-miR-2276	CLIP-seq
MIRT1501306	hsa-miR-2278	CLIP-seq
MIRT1501307	hsa-miR-2355-3p	CLIP-seq
MIRT1501308	hsa-miR-2964a-3p	CLIP-seq
MIRT1501309	hsa-miR-29a	CLIP-seq
MIRT1501310	hsa-miR-29b	CLIP-seq
MIRT1501311	hsa-miR-29c	CLIP-seq
MIRT1501312	hsa-miR-300	CLIP-seq
MIRT1501313	hsa-miR-3126-3p	CLIP-seq
MIRT1501314	hsa-miR-3128	CLIP-seq
MIRT1501315	hsa-miR-3143	CLIP-seq
MIRT1501316	hsa-miR-3147	CLIP-seq
MIRT1501317	hsa-miR-3148	CLIP-seq
MIRT1501318	hsa-miR-3152-3p	CLIP-seq
MIRT1501319	hsa-miR-340	CLIP-seq
MIRT1501320	hsa-miR-34a	CLIP-seq
MIRT1501321	hsa-miR-3607-3p	CLIP-seq
MIRT1501322	hsa-miR-3614-5p	CLIP-seq
MIRT1501323	hsa-miR-3616-5p	CLIP-seq
MIRT1501324	hsa-miR-3647-5p	CLIP-seq
MIRT1501325	hsa-miR-3649	CLIP-seq
MIRT1501326	hsa-miR-3663-3p	CLIP-seq
MIRT1501327	hsa-miR-3686	CLIP-seq
MIRT1501328	hsa-miR-381	CLIP-seq
MIRT1501329	hsa-miR-3908	CLIP-seq
MIRT1501330	hsa-miR-3909	CLIP-seq
MIRT1501331	hsa-miR-3934	CLIP-seq
MIRT1501332	hsa-miR-3942-5p	CLIP-seq
MIRT1501333	hsa-miR-3978	CLIP-seq
MIRT1501334	hsa-miR-4262	CLIP-seq
MIRT1501335	hsa-miR-4298	CLIP-seq
MIRT1501336	hsa-miR-4310	CLIP-seq
MIRT1501337	hsa-miR-433	CLIP-seq
MIRT1501338	hsa-miR-4418	CLIP-seq
MIRT1501339	hsa-miR-4425	CLIP-seq
MIRT1501340	hsa-miR-449a	CLIP-seq
MIRT1501341	hsa-miR-449b	CLIP-seq
MIRT1501342	hsa-miR-451b	CLIP-seq
MIRT1501343	hsa-miR-4641	CLIP-seq
MIRT1501344	hsa-miR-4652-3p	CLIP-seq
MIRT1501345	hsa-miR-4662a-3p	CLIP-seq
MIRT1501346	hsa-miR-4666-3p	CLIP-seq
MIRT1501347	hsa-miR-4666-5p	CLIP-seq
MIRT1501348	hsa-miR-4694-5p	CLIP-seq
MIRT1501349	hsa-miR-4698	CLIP-seq
MIRT1501350	hsa-miR-4700-3p	CLIP-seq
MIRT1501351	hsa-miR-4703-5p	CLIP-seq
MIRT1501352	hsa-miR-4714-3p	CLIP-seq
MIRT1501353	hsa-miR-4720-5p	CLIP-seq
MIRT1501354	hsa-miR-4724-5p	CLIP-seq
MIRT1501355	hsa-miR-4742-5p	CLIP-seq
MIRT1501356	hsa-miR-4766-3p	CLIP-seq
MIRT1501357	hsa-miR-4789-5p	CLIP-seq
MIRT1501358	hsa-miR-4797-5p	CLIP-seq
MIRT1501359	hsa-miR-4799-3p	CLIP-seq
MIRT1501360	hsa-miR-4802-3p	CLIP-seq
MIRT1501361	hsa-miR-501-3p	CLIP-seq
MIRT1501362	hsa-miR-502-3p	CLIP-seq
MIRT1501363	hsa-miR-509-3-5p	CLIP-seq
MIRT1501364	hsa-miR-5095	CLIP-seq
MIRT1501365	hsa-miR-509-5p	CLIP-seq
MIRT1501366	hsa-miR-511	CLIP-seq
MIRT1501367	hsa-miR-520d-5p	CLIP-seq
MIRT1501368	hsa-miR-524-5p	CLIP-seq
MIRT1501369	hsa-miR-548c-3p	CLIP-seq
MIRT1501370	hsa-miR-548m	CLIP-seq
MIRT1501371	hsa-miR-548t	CLIP-seq
MIRT1501372	hsa-miR-561	CLIP-seq
MIRT1501373	hsa-miR-573	CLIP-seq
MIRT1501374	hsa-miR-676	CLIP-seq
MIRT1501375	hsa-miR-764	CLIP-seq
MIRT1501376	hsa-miR-890	CLIP-seq
MIRT1501377	hsa-miR-892a	CLIP-seq
MIRT1501312	hsa-miR-300	CLIP-seq
MIRT1501328	hsa-miR-381	CLIP-seq
MIRT1501346	hsa-miR-4666-3p	CLIP-seq
MIRT1501291	hsa-miR-1179	CLIP-seq
MIRT1501292	hsa-miR-1206	CLIP-seq
MIRT1501293	hsa-miR-125a-3p	CLIP-seq
MIRT1501296	hsa-miR-141	CLIP-seq
MIRT1501301	hsa-miR-186	CLIP-seq
MIRT1501302	hsa-miR-200a	CLIP-seq
MIRT2150694	hsa-miR-2115	CLIP-seq
MIRT1501304	hsa-miR-219-2-3p	CLIP-seq
MIRT1501306	hsa-miR-2278	CLIP-seq
MIRT1501312	hsa-miR-300	CLIP-seq
MIRT1501313	hsa-miR-3126-3p	CLIP-seq
MIRT1501315	hsa-miR-3143	CLIP-seq
MIRT1501317	hsa-miR-3148	CLIP-seq
MIRT1501318	hsa-miR-3152-3p	CLIP-seq
MIRT2150695	hsa-miR-3154	CLIP-seq
MIRT2150696	hsa-miR-3159	CLIP-seq
MIRT2150697	hsa-miR-3650	CLIP-seq
MIRT2150698	hsa-miR-3662	CLIP-seq
MIRT1501328	hsa-miR-381	CLIP-seq
MIRT1501331	hsa-miR-3934	CLIP-seq
MIRT2150699	hsa-miR-3938	CLIP-seq
MIRT1501333	hsa-miR-3978	CLIP-seq
MIRT1501336	hsa-miR-4310	CLIP-seq
MIRT1501337	hsa-miR-433	CLIP-seq
MIRT2150700	hsa-miR-4506	CLIP-seq
MIRT1501342	hsa-miR-451b	CLIP-seq
MIRT1501344	hsa-miR-4652-3p	CLIP-seq
MIRT1501345	hsa-miR-4662a-3p	CLIP-seq
MIRT1501346	hsa-miR-4666-3p	CLIP-seq
MIRT1501347	hsa-miR-4666-5p	CLIP-seq
MIRT1501348	hsa-miR-4694-5p	CLIP-seq
MIRT1501349	hsa-miR-4698	CLIP-seq
MIRT2150701	hsa-miR-4705	CLIP-seq
MIRT1501352	hsa-miR-4714-3p	CLIP-seq
MIRT1501354	hsa-miR-4724-5p	CLIP-seq
MIRT2150702	hsa-miR-4775	CLIP-seq
MIRT1501357	hsa-miR-4789-5p	CLIP-seq
MIRT1501358	hsa-miR-4797-5p	CLIP-seq
MIRT1501360	hsa-miR-4802-3p	CLIP-seq
MIRT1501366	hsa-miR-511	CLIP-seq
MIRT2150703	hsa-miR-516a-3p	CLIP-seq
MIRT2150704	hsa-miR-516b	CLIP-seq
MIRT1501369	hsa-miR-548c-3p	CLIP-seq
MIRT2150705	hsa-miR-548o	CLIP-seq
MIRT1501372	hsa-miR-561	CLIP-seq
MIRT2150706	hsa-miR-579	CLIP-seq
MIRT2150707	hsa-miR-590-3p	CLIP-seq
MIRT2150708	hsa-miR-629	CLIP-seq
MIRT2150709	hsa-miR-664	CLIP-seq
MIRT2150710	hsa-miR-7	CLIP-seq
MIRT1501375	hsa-miR-764	CLIP-seq
MIRT2150711	hsa-miR-875-3p	CLIP-seq
MIRT1501291	hsa-miR-1179	CLIP-seq
MIRT1501292	hsa-miR-1206	CLIP-seq
MIRT1501293	hsa-miR-125a-3p	CLIP-seq
MIRT1501294	hsa-miR-1283	CLIP-seq
MIRT1501295	hsa-miR-1302	CLIP-seq
MIRT1501296	hsa-miR-141	CLIP-seq
MIRT1501297	hsa-miR-181a	CLIP-seq
MIRT1501298	hsa-miR-181b	CLIP-seq
MIRT1501299	hsa-miR-181c	CLIP-seq
MIRT1501300	hsa-miR-181d	CLIP-seq
MIRT1501302	hsa-miR-200a	CLIP-seq
MIRT2150694	hsa-miR-2115	CLIP-seq
MIRT1501303	hsa-miR-217	CLIP-seq
MIRT1501304	hsa-miR-219-2-3p	CLIP-seq
MIRT1501305	hsa-miR-2276	CLIP-seq
MIRT1501306	hsa-miR-2278	CLIP-seq
MIRT1501307	hsa-miR-2355-3p	CLIP-seq
MIRT1501308	hsa-miR-2964a-3p	CLIP-seq
MIRT1501309	hsa-miR-29a	CLIP-seq
MIRT1501310	hsa-miR-29b	CLIP-seq
MIRT1501311	hsa-miR-29c	CLIP-seq
MIRT1501312	hsa-miR-300	CLIP-seq
MIRT1501313	hsa-miR-3126-3p	CLIP-seq
MIRT1501314	hsa-miR-3128	CLIP-seq
MIRT1501316	hsa-miR-3147	CLIP-seq
MIRT1501317	hsa-miR-3148	CLIP-seq
MIRT1501320	hsa-miR-34a	CLIP-seq
MIRT1501321	hsa-miR-3607-3p	CLIP-seq
MIRT2371185	hsa-miR-3609	CLIP-seq
MIRT1501325	hsa-miR-3649	CLIP-seq
MIRT2150698	hsa-miR-3662	CLIP-seq
MIRT1501326	hsa-miR-3663-3p	CLIP-seq
MIRT1501327	hsa-miR-3686	CLIP-seq
MIRT1501328	hsa-miR-381	CLIP-seq
MIRT1501330	hsa-miR-3909	CLIP-seq
MIRT2150699	hsa-miR-3938	CLIP-seq
MIRT1501333	hsa-miR-3978	CLIP-seq
MIRT1501334	hsa-miR-4262	CLIP-seq
MIRT1501335	hsa-miR-4298	CLIP-seq
MIRT1501336	hsa-miR-4310	CLIP-seq
MIRT1501337	hsa-miR-433	CLIP-seq
MIRT1501338	hsa-miR-4418	CLIP-seq
MIRT1501339	hsa-miR-4425	CLIP-seq
MIRT1501340	hsa-miR-449a	CLIP-seq
MIRT1501341	hsa-miR-449b	CLIP-seq
MIRT2150700	hsa-miR-4506	CLIP-seq
MIRT1501344	hsa-miR-4652-3p	CLIP-seq
MIRT1501345	hsa-miR-4662a-3p	CLIP-seq
MIRT1501346	hsa-miR-4666-3p	CLIP-seq
MIRT1501349	hsa-miR-4698	CLIP-seq
MIRT2150701	hsa-miR-4705	CLIP-seq
MIRT1501352	hsa-miR-4714-3p	CLIP-seq
MIRT1501353	hsa-miR-4720-5p	CLIP-seq
MIRT1501354	hsa-miR-4724-5p	CLIP-seq
MIRT1501355	hsa-miR-4742-5p	CLIP-seq
MIRT1501357	hsa-miR-4789-5p	CLIP-seq
MIRT1501359	hsa-miR-4799-3p	CLIP-seq
MIRT1501363	hsa-miR-509-3-5p	CLIP-seq
MIRT1501365	hsa-miR-509-5p	CLIP-seq
MIRT2150703	hsa-miR-516a-3p	CLIP-seq
MIRT2150704	hsa-miR-516b	CLIP-seq
MIRT1501367	hsa-miR-520d-5p	CLIP-seq
MIRT1501368	hsa-miR-524-5p	CLIP-seq
MIRT2371186	hsa-miR-548ah	CLIP-seq
MIRT1501369	hsa-miR-548c-3p	CLIP-seq
MIRT1501370	hsa-miR-548m	CLIP-seq
MIRT1501371	hsa-miR-548t	CLIP-seq
MIRT2150708	hsa-miR-629	CLIP-seq
MIRT1501374	hsa-miR-676	CLIP-seq
MIRT2150710	hsa-miR-7	CLIP-seq
MIRT2150711	hsa-miR-875-3p	CLIP-seq
MIRT1501301	hsa-miR-186	CLIP-seq
MIRT1501304	hsa-miR-219-2-3p	CLIP-seq
MIRT1501319	hsa-miR-340	CLIP-seq
MIRT1501366	hsa-miR-511	CLIP-seq
MIRT1501294	hsa-miR-1283	CLIP-seq
MIRT1501297	hsa-miR-181a	CLIP-seq
MIRT1501298	hsa-miR-181b	CLIP-seq
MIRT1501299	hsa-miR-181c	CLIP-seq
MIRT1501300	hsa-miR-181d	CLIP-seq
MIRT1501304	hsa-miR-219-2-3p	CLIP-seq
MIRT1501309	hsa-miR-29a	CLIP-seq
MIRT1501310	hsa-miR-29b	CLIP-seq
MIRT1501311	hsa-miR-29c	CLIP-seq
MIRT1501321	hsa-miR-3607-3p	CLIP-seq
MIRT1501326	hsa-miR-3663-3p	CLIP-seq
MIRT1501327	hsa-miR-3686	CLIP-seq
MIRT1501334	hsa-miR-4262	CLIP-seq
MIRT1501344	hsa-miR-4652-3p	CLIP-seq
MIRT1501346	hsa-miR-4666-3p	CLIP-seq
MIRT1501354	hsa-miR-4724-5p	CLIP-seq
MIRT1501355	hsa-miR-4742-5p	CLIP-seq
MIRT1501357	hsa-miR-4789-5p	CLIP-seq
MIRT1501296	hsa-miR-141	CLIP-seq
MIRT1501301	hsa-miR-186	CLIP-seq
MIRT1501302	hsa-miR-200a	CLIP-seq
MIRT1501306	hsa-miR-2278	CLIP-seq
MIRT1501312	hsa-miR-300	CLIP-seq
MIRT1501315	hsa-miR-3143	CLIP-seq
MIRT1501318	hsa-miR-3152-3p	CLIP-seq
MIRT1501328	hsa-miR-381	CLIP-seq
MIRT1501329	hsa-miR-3908	CLIP-seq
MIRT1501332	hsa-miR-3942-5p	CLIP-seq
MIRT2664594	hsa-miR-410	CLIP-seq
MIRT1501342	hsa-miR-451b	CLIP-seq
MIRT1501345	hsa-miR-4662a-3p	CLIP-seq
MIRT1501346	hsa-miR-4666-3p	CLIP-seq
MIRT1501349	hsa-miR-4698	CLIP-seq
MIRT1501351	hsa-miR-4703-5p	CLIP-seq
MIRT1501356	hsa-miR-4766-3p	CLIP-seq
MIRT2150702	hsa-miR-4775	CLIP-seq
MIRT1501357	hsa-miR-4789-5p	CLIP-seq
MIRT1501358	hsa-miR-4797-5p	CLIP-seq
MIRT2150705	hsa-miR-548o	CLIP-seq
MIRT2664595	hsa-miR-548p	CLIP-seq
MIRT1501372	hsa-miR-561	CLIP-seq
MIRT2150707	hsa-miR-590-3p	CLIP-seq
MIRT1501296	hsa-miR-141	CLIP-seq
MIRT1501301	hsa-miR-186	CLIP-seq
MIRT1501302	hsa-miR-200a	CLIP-seq
MIRT1501306	hsa-miR-2278	CLIP-seq
MIRT1501312	hsa-miR-300	CLIP-seq
MIRT1501315	hsa-miR-3143	CLIP-seq
MIRT1501318	hsa-miR-3152-3p	CLIP-seq
MIRT1501328	hsa-miR-381	CLIP-seq
MIRT1501329	hsa-miR-3908	CLIP-seq
MIRT1501332	hsa-miR-3942-5p	CLIP-seq
MIRT1501342	hsa-miR-451b	CLIP-seq
MIRT1501345	hsa-miR-4662a-3p	CLIP-seq
MIRT1501346	hsa-miR-4666-3p	CLIP-seq
MIRT1501349	hsa-miR-4698	CLIP-seq
MIRT1501351	hsa-miR-4703-5p	CLIP-seq
MIRT1501356	hsa-miR-4766-3p	CLIP-seq
MIRT2150702	hsa-miR-4775	CLIP-seq
MIRT1501357	hsa-miR-4789-5p	CLIP-seq
MIRT1501358	hsa-miR-4797-5p	CLIP-seq
MIRT2664595	hsa-miR-548p	CLIP-seq
MIRT1501372	hsa-miR-561	CLIP-seq
MIRT2150707	hsa-miR-590-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EP300	Unknown	11486036
HDAC5	Activation	18632988
KAT2B	Unknown	11486036
NFKB1	Repression	16784892
NFKB1	Unknown	17438126
RELA	Repression	16784892
RELA	Unknown	17438126
SP1	Activation	22553354
SP3	Activation	22553354
SP4	Activation	22553354
TBX21	Unknown	21272048

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	9857059
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	1655281, 1946405, 16260628
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000400	Function	Four-way junction DNA binding	IDA	18026119
GO:0000723	Process	Telomere maintenance	IEA
GO:0000723	Process	Telomere maintenance	ISO
GO:0000724	Process	Double-strand break repair via homologous recombination	IMP	18026119
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	9857059
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	30241939
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	15329343
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	16260628
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IEA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IMP	15329343
GO:0001217	Function	DNA-binding transcription repressor activity	TAS	1946405
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	1655281
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	30241939
GO:0003677	Function	DNA binding	IDA	21729784
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003723	Function	RNA binding	IDA	21729784
GO:0005515	Function	Protein binding	IPI	7853498, 9016636, 10369680, 14744866, 18026119, 19879840, 21988832, 23385818, 24981860, 27705803, 27939641, 28514442, 32296183, 32814053, 33961781, 35140242, 35271311
GO:0005634	Component	Nucleus	IDA	10791971, 16260628, 18026119
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IMP	22065573
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005677	Component	Chromatin silencing complex	IEA
GO:0006275	Process	Regulation of DNA replication	IMP	25016522
GO:0006281	Process	DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	ISO
GO:0006310	Process	DNA recombination	IEA
GO:0006338	Process	Chromatin remodeling	IDA	21303910
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	15329343
GO:0006403	Process	RNA localization	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	18026119
GO:0007283	Process	Spermatogenesis	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0010225	Process	Response to UV-C	IEA
GO:0010225	Process	Response to UV-C	IMP	18026119
GO:0010467	Process	Gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IMP	22065573
GO:0016363	Component	Nuclear matrix	IEA
GO:0030097	Process	Hemopoiesis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030183	Process	B cell differentiation	IEA
GO:0031011	Component	Ino80 complex	IDA	18026119, 21303910
GO:0031519	Component	PcG protein complex	IBA
GO:0031519	Component	PcG protein complex	IEA
GO:0032688	Process	Negative regulation of interferon-beta production	IDA	16260628
GO:0033044	Process	Regulation of chromosome organization	IMP	26340092
GO:0034644	Process	Cellular response to UV	IMP	18026119
GO:0034696	Process	Response to prostaglandin F	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045739	Process	Positive regulation of DNA repair	IEA
GO:0045739	Process	Positive regulation of DNA repair	ISO
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	27641337
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IC	30241939
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045995	Process	Regulation of embryonic development	IEA
GO:0045995	Process	Regulation of embryonic development	ISO
GO:0046332	Function	SMAD binding	IMP	15329343
GO:0046872	Function	Metal ion binding	IEA
GO:0048593	Process	Camera-type eye morphogenesis	IEA
GO:0051276	Process	Chromosome organization	IEA
GO:0051726	Process	Regulation of cell cycle	IMP	26340092
GO:0060382	Process	Regulation of DNA strand elongation	IMP	25016522
GO:0061052	Process	Negative regulation of cell growth involved in cardiac muscle cell development	IEA
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0071707	Process	Immunoglobulin heavy chain V-D-J recombination	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	15674325
GO:1902894	Process	Negative regulation of miRNA transcription	IEA
GO:1904507	Process	Positive regulation of telomere maintenance in response to DNA damage	IEA
GO:1904507	Process	Positive regulation of telomere maintenance in response to DNA damage	ISO
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 600013
• HGNC: 12856
• e!Ensembl: ENSG00000100811

Protein

• UniProt ID: P25490
• Protein name: Transcriptional repressor protein YY1 (Delta transcription factor) (INO80 complex subunit S) (NF-E1) (Yin and yang 1) (YY-1)
• Protein function: Multifunctional transcription factor that exhibits positive and negative control on a large number of cellular and viral genes by binding to sites overlapping the transcription start site (PubMed:15329343, PubMed:17721549, PubMed:24326773, PubMe
• PDB: 1UBD, 1ZNM, 4C5I
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	325 → 347	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	353 → 377	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	383 → 407	Zinc finger, C2H2 type	Domain

• Sequence:

  MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDHG
  GGGGHGHAGHHHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDG
  LRAEDGFEDQILIPVPAPAGGDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKGGGKKS
  GKKSYLSGGAGAAGGGGADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEE
  QIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPH
  KGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGC
  GKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ

• Sequence length: 414

Pathways

KEGG:

ATP-dependent chromatin remodeling
Polycomb repressive complex

Reactome:

UCH proteinases
DNA Damage Recognition in GG-NER
TFAP2 (AP-2) family regulates transcription of growth factors and their receptors
Estrogen-dependent gene expression

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Gabriele de Vries syndrome	Likely pathogenic; Pathogenic	rs1890697895, rs759536629, rs2139605753, rs2139605796, rs2139605785, rs2139604254, rs2549138613, rs2549138621, rs2549138620, rs2549139334, rs2549127399, rs2549139328, rs2549139366, rs2549139353, rs1189366704, rs1131692043, rs1131692163, rs1131692044, rs1131692045, rs1131692046, rs1891340236	RCV001331054 RCV001507311 RCV001779355 RCV005603735 RCV005860260 RCV002227001 RCV002227415 RCV002287620 RCV002291110 RCV003110133 RCV003148265 RCV003329126 RCV003333895 RCV003388878 RCV004555426 RCV004595123 RCV000494725 RCV000494727 RCV000494721 RCV000494726 RCV000494728 RCV001254142	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Intellectual disability	Likely pathogenic; Pathogenic	rs2139605753, rs759536629	RCV002295351 RCV005626492	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder	Likely pathogenic	rs2139605815	RCV002277707	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COMPLEX NEURODEVELOPMENTAL DISORDER	—	ClinGen, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL AND EPILEPTIC ENCEPHALOPATHY 78	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE CERVICAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
YY1-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	8338950, 8501986		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11325643, 11380394, 11839375, 1328776, 1493438, 1648373, 1824678, 2174915, 2523429, 2529925, 2848865, 29616858, 8118037, 8756082, 9375746		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30942957		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	25787250		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11325643, 11839375, 1824678, 2523429, 29616858		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	20081364		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21443683, 33920138	Associate	★☆☆☆☆ Found in Text Mining only
AMELOGENESIS IMPERFECTA, HYPOPLASTIC/HYPOMATURATION, X-LINKED 1	Amelogenesis Imperfecta, X-Linked	BEFREE	29358858		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	31828582	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24884523, 28867247, 29168185		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	12740597		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	24035914		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	24035914		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29545108		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30229869, 30539840, 31159863, 31505424, 32983133, 34061447, 36189314, 36532040, 36550514	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11167957, 18414509, 18423564		★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	35172867	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	2136770		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	31838722, 35199341	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	29358858		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	21272048, 34279042	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	31040909		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	22467534		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	31251827		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	15536151, 3676110		★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	15536151, 3676110		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29536411		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	1654480, 1751368, 1907927, 2543592		★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	18339860		★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	25644713	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	35199341	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	20920292, 35199341	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18218085, 21666725, 22440256, 22710444, 30381079		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15870067, 18218085, 19566924, 20025767, 21993297, 25501155, 25885449, 28492540, 30887707, 34063990, 35103856, 35791393	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	22064860	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	20081364, 2500532		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21993297, 24674326, 28485541, 33436409, 35266011	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	29052509, 7954530		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28412749, 32557953, 34563230, 34730201, 34863279, 36669583, 36938729, 36999621, 37143506, 37408047, 37928273, 39447409	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29536411		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28972861, 30251328, 8157272		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19208743, 26768613	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31404611	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19483472, 33232269, 34834139, 35508649, 35791393	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29470526	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19208743		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	32196466	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	31705051	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	37840136	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	31495264		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	32572898	Inhibit	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	8820404		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	35199341	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	CTD_human_DG	21792014		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25672374, 29470526		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25672374, 29470526		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	11325643, 11839375, 1824678, 2523429, 29616858, 9369435		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34898474, 35864972, 37817227	Associate	★☆☆☆☆ Found in Text Mining only
Choroid Plexus Carcinoma	Choroid Plexus Carcinoma	BEFREE	28580685		★☆☆☆☆ Found in Text Mining only
Chromosome 17q21.31 Deletion Syndrome	Chromosome 17q21.31 deletion syndrome	Pubtator	32077676, 33369188, 35027293, 39775551	Associate	★☆☆☆☆ Found in Text Mining only
Chronic leukemia (category)	Leukemia	BEFREE	2492834		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	1654993		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21565439		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	28575647	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10074927, 19360355, 20525792, 23208495		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23208495, 30902880		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20525792, 28929494, 31828582, 34445183, 35266011, 35791393, 36991484, 37340443, 39959936	Associate	★☆☆☆☆ Found in Text Mining only
Congenital central hypoventilation syndrome	Congenital central hypoventilation syndrome	Pubtator	18199779	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	2147972, 2523031		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital contractural arachnodactyly	Pubtator	35864972	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	12754214		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	7954530		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	10652351		★☆☆☆☆ Found in Text Mining only
Delta-Beta Thalassemia	Delta-Beta Thalassemia	BEFREE	6325696		★☆☆☆☆ Found in Text Mining only
delta-Thalassemia	Delta-Thalassemia	BEFREE	3676110		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	33369188, 35172867	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15234341, 23193188		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15234341, 23193188		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	30910956	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32041280	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17310221		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31028762, 31534017		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	25698133		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	20081364		★☆☆☆☆ Found in Text Mining only
Dystonia	Dystonia	Pubtator	34686877, 35172867, 35199341, 38042508	Associate	★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	12740597		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	27259051, 35791393, 37052291	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	35199341	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	19208743		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30755813		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	23919806, 35435118	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23919806	Inhibit	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32699215, 38065955	Associate	★☆☆☆☆ Found in Text Mining only
Familial benign pemphigus	Benign Pemphigus	LHGDN	15955096		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31084931		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	25698133, 7651730		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	38110419	Associate	★☆☆☆☆ Found in Text Mining only
GABRIELE-DE VRIES SYNDROME	Gabriele De Vries Syndrome	UNIPROT_DG	21076407, 28575647		★☆☆☆☆ Found in Text Mining only
GABRIELE-DE VRIES SYNDROME	Gabriele De Vries Syndrome	ORPHANET_DG	28575647		★☆☆☆☆ Found in Text Mining only
GABRIELE-DE VRIES SYNDROME	Gabriele De Vries Syndrome	GENOMICS_ENGLAND_DG	28575647		★☆☆☆☆ Found in Text Mining only
Gabriele-de Vries syndrome	Gabriele De Vries Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
GABRIELE-DE VRIES SYNDROME	Gabriele De Vries Syndrome	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22322893, 30365062		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22322893, 30365062, 31142741		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	19235591		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29138857		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36647288	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	31534017		★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	35199341	Associate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	12965261		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	12754214		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	37840136	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	8876635		★☆☆☆☆ Found in Text Mining only
Hemoglobin F Disease	Hemoglobinopathy	BEFREE	15536151		★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	29358858	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	33084547	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	21369802		★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	BEFREE	20081364		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	23193188		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20430007		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	12754214		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	12754214		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25644713	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35163649	Stimulate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	8391544		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28575647		★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	24326773, 25787250, 26910132, 28472826		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	21076407		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual Disability	Mental retardation	CTD_human_DG	21076407		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual Disability	Intellectual developmental disorder	Pubtator	32077676, 33369188, 39775551	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual Disability	Mental retardation	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36972403	Associate	★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	17973241		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	35974388	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	28485541	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	1907927, 2137546, 2143795, 2492834		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	22801367, 25765655, 35163649	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31537905, 33318617, 36424383	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12393438, 1654480, 2030157, 2547833, 7696934, 7947271, 8289473, 8750622		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	2030157		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	2492834, 2554994, 9379030		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21332389, 22391813, 26292095, 26800240, 29272897, 30760518, 31695789, 31799179		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	26292095		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	26786659		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29620222	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21272048	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	8082298		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28485541	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	11325643		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11325643, 1830192, 8698315		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	8756082		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	8552567		★☆☆☆☆ Found in Text Mining only
Lysinuric Protein Intolerance	Lysinuric Protein Intolerance	BEFREE	10364825		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	28505004		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18218085, 20025767, 21666725, 22440256, 22710444, 30381079		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28972861, 30251328, 8157272		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27074573, 29168185, 31631174		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23246440		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25727947, 28827574		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25698133		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29536411		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16548774, 17431117, 18339860, 19342874, 19360355, 20081375, 22440256, 24884523, 25619146, 25644713, 26104682, 28447715, 28575647, 29322514, 29869834, 29921695, 30760518, 31005030, 31028762, 31799179, 31846633, 8756082		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	22467534		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25672374, 29470526		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10074927, 19360355, 20525792, 23208495		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15805285		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18218085		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19208738, 26104682, 31858560, 35156513	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26104682, 7954530		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	19235591		★☆☆☆☆ Found in Text Mining only
Mental deficiency	Mental retardation	CTD_human_DG	21076407		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	23630070		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	35665561	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	28505004, 34597666	Associate	★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	8182927		★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	9595857		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	20561060		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	35172867	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24481661, 36593359, 40156642	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	24970600		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10464430, 9595857, 9763196		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21152067	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	8182927		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	2137546, 8289473		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	1654480, 20413659, 2543592, 8396849		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	1825681		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	30420297	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30718276		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	30718276	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11711542, 15695120, 16548774, 16784892, 17431117, 17911631, 18753137, 19208743, 20081375, 21332389, 21666725, 22322893, 22440256, 23208495, 23246440, 2478232, 24884523, 24970812, 2501027, 2523031, 2523429, 2554994, 25644713, 25787250, 26104682, 26800240, 27074573, 28363333, 28867247, 28972861, 29322514, 29470526, 29869834, 29921695, 31799179, 31824839, 7651730, 7954530, 8157272, 8698315, 9111581		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	22467534		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	39731187, 8753872	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	38110419	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30804239		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	12965261		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30285651		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16061473, 27306217		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20460359		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	18339860, 18488713		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	18339860, 18488713		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22047406	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19208743, 32199224, 32563147, 35791393	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27074573, 29168185, 31631174		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	24884523, 28867247		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31404611, 35659199	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25698133, 30290400		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	35199341	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	1991851		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	35665561	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	29157796		★☆☆☆☆ Found in Text Mining only
Posteriorly rotated ear	Posteriorly Rotated Ear	HPO_DG			★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	1493438, 2848865		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	1328776, 1493438, 2523429, 2848865, 8118037		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	10674905, 15061208, 1655121, 17133429, 1826223, 1826936, 1837811, 2147972, 2523429, 2526664, 2542699, 2547833, 2848865, 7905617, 8208530, 8219197, 8459224, 9379030		★☆☆☆☆ Found in Text Mining only
Profound Mental Retardation	Mental retardation	CTD_human_DG	21076407		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15942652		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21814516, 24481661, 25174820, 34897998, 37771187	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28592290	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	25775215, 26786659, 31028762		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	7954530, 9111581		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31028762		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	37925496	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	20068066	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	2154031, 29545108, 30229869		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	27645107		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	1970246		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	GWASCAT_DG	30738427		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28447715		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25954903		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33315124, 37401236	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29970878		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25727947, 28827574		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24674326, 25727947, 28592880, 33794762, 33994849, 36528654	Associate	★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	34938355, 35199341	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	1970246		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	1830192, 8640683		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	35791393	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	23690926	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25698133		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25698133		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	23690926	Associate	★☆☆☆☆ Found in Text Mining only
Tremor	Tremor	Pubtator	35172867	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30594392, 33683171, 36754085, 37286143	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	23705901	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	17201133, 21483740, 34720049, 34818994	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	CTD_human_DG	21792014		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	10760685, 21792014, 29470526, 38555994, 8137827	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations