XRCC3 (X-ray repair cross complementing 3)

Gene

• Entrez ID: 7517
• Gene name: X-ray repair cross complementing 3
• Gene symbol: XRCC3
• Synonyms (NCBI Gene): CMM6
• Chromosome: 14
• Chromosome location: 14q32.33
• Summary: This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene functionally complements Chinese hamster irs1SF, a repair-deficient mutant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT514560	hsa-miR-548aa	HITS-CLIP	21572407
MIRT514559	hsa-miR-548ap-3p	HITS-CLIP	21572407
MIRT514558	hsa-miR-548t-3p	HITS-CLIP	21572407
MIRT503293	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT707104	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT503292	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT508307	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT508306	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT508305	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT503291	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT503290	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT508304	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT503293	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT503292	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT508307	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT508306	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT508305	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT503291	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT503290	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT508304	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT503293	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT503292	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT503291	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT503290	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT609260	hsa-miR-1910-3p	HITS-CLIP	23824327
MIRT609259	hsa-miR-6511a-5p	HITS-CLIP	23824327
MIRT609258	hsa-miR-4514	HITS-CLIP	23824327
MIRT609257	hsa-miR-4692	HITS-CLIP	23824327
MIRT609256	hsa-miR-4645-5p	HITS-CLIP	23824327
MIRT609255	hsa-miR-4673	HITS-CLIP	23824327
MIRT609254	hsa-miR-6075	HITS-CLIP	23824327
MIRT609260	hsa-miR-1910-3p	HITS-CLIP	23824327
MIRT609259	hsa-miR-6511a-5p	HITS-CLIP	23824327
MIRT609258	hsa-miR-4514	HITS-CLIP	23824327
MIRT609257	hsa-miR-4692	HITS-CLIP	23824327
MIRT609256	hsa-miR-4645-5p	HITS-CLIP	23824327
MIRT609255	hsa-miR-4673	HITS-CLIP	23824327
MIRT609254	hsa-miR-6075	HITS-CLIP	23824327
MIRT609260	hsa-miR-1910-3p	HITS-CLIP	23824327
MIRT609259	hsa-miR-6511a-5p	HITS-CLIP	23824327
MIRT609258	hsa-miR-4514	HITS-CLIP	23824327
MIRT609257	hsa-miR-4692	HITS-CLIP	23824327
MIRT609256	hsa-miR-4645-5p	HITS-CLIP	23824327
MIRT609255	hsa-miR-4673	HITS-CLIP	23824327
MIRT609254	hsa-miR-6075	HITS-CLIP	23824327
MIRT613421	hsa-miR-548an	HITS-CLIP	23824327
MIRT613420	hsa-miR-6768-3p	HITS-CLIP	23824327
MIRT613419	hsa-miR-4484	HITS-CLIP	23824327
MIRT609260	hsa-miR-1910-3p	HITS-CLIP	23824327
MIRT609259	hsa-miR-6511a-5p	HITS-CLIP	23824327
MIRT609258	hsa-miR-4514	HITS-CLIP	23824327
MIRT609257	hsa-miR-4692	HITS-CLIP	23824327
MIRT609256	hsa-miR-4645-5p	HITS-CLIP	23824327
MIRT609255	hsa-miR-4673	HITS-CLIP	23824327
MIRT609254	hsa-miR-6075	HITS-CLIP	23824327
MIRT609260	hsa-miR-1910-3p	HITS-CLIP	23824327
MIRT609259	hsa-miR-6511a-5p	HITS-CLIP	23824327
MIRT609258	hsa-miR-4514	HITS-CLIP	23824327
MIRT609257	hsa-miR-4692	HITS-CLIP	23824327
MIRT609256	hsa-miR-4645-5p	HITS-CLIP	23824327
MIRT609255	hsa-miR-4673	HITS-CLIP	23824327
MIRT609254	hsa-miR-6075	HITS-CLIP	23824327
MIRT514565	hsa-miR-548ac	PAR-CLIP	21572407
MIRT514564	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT514563	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT514562	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT514561	hsa-miR-548z	PAR-CLIP	21572407
MIRT514560	hsa-miR-548aa	PAR-CLIP	21572407
MIRT514559	hsa-miR-548ap-3p	PAR-CLIP	21572407
MIRT514558	hsa-miR-548t-3p	PAR-CLIP	21572407
MIRT503293	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT503292	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508307	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT508306	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT508305	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT503291	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT503290	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508304	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT514565	hsa-miR-548ac	PAR-CLIP	21572407
MIRT514564	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT514563	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT514562	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT514561	hsa-miR-548z	PAR-CLIP	21572407
MIRT514560	hsa-miR-548aa	PAR-CLIP	21572407
MIRT514559	hsa-miR-548ap-3p	PAR-CLIP	21572407
MIRT514558	hsa-miR-548t-3p	PAR-CLIP	21572407
MIRT503292	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508307	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT508306	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT508305	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT503291	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT503290	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508304	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT503293	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT503292	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508307	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT508306	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT508305	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT503291	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT503290	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508304	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT514565	hsa-miR-548ac	PAR-CLIP	23446348
MIRT514564	hsa-miR-548bb-3p	PAR-CLIP	23446348
MIRT514563	hsa-miR-548d-3p	PAR-CLIP	23446348
MIRT514562	hsa-miR-548h-3p	PAR-CLIP	23446348
MIRT514561	hsa-miR-548z	PAR-CLIP	23446348
MIRT514560	hsa-miR-548aa	PAR-CLIP	23446348
MIRT514559	hsa-miR-548ap-3p	PAR-CLIP	23446348
MIRT514558	hsa-miR-548t-3p	PAR-CLIP	23446348
MIRT503293	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT503292	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508307	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT508306	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT508305	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT503291	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT503290	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508304	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT503292	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508307	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT508306	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT508305	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT503291	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT503290	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508304	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT503293	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT503292	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT503291	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT503290	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT482713	hsa-miR-1295b-5p	PAR-CLIP	23592263
MIRT482712	hsa-miR-1912	PAR-CLIP	23592263
MIRT114265	hsa-miR-6746-3p	PAR-CLIP	23592263
MIRT482711	hsa-miR-4257	PAR-CLIP	23592263
MIRT482710	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT482709	hsa-miR-4784	PAR-CLIP	23592263
MIRT482707	hsa-miR-6134	PAR-CLIP	23592263
MIRT482708	hsa-miR-765	PAR-CLIP	23592263
MIRT482706	hsa-miR-4710	PAR-CLIP	23592263
MIRT482705	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT482704	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT482703	hsa-miR-6748-5p	PAR-CLIP	23592263
MIRT482702	hsa-miR-4689	PAR-CLIP	23592263
MIRT482701	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT482700	hsa-miR-1262	PAR-CLIP	23592263
MIRT482699	hsa-miR-4701-3p	PAR-CLIP	23592263
MIRT482697	hsa-miR-6736-5p	PAR-CLIP	23592263
MIRT482698	hsa-miR-4651	PAR-CLIP	23592263
MIRT482713	hsa-miR-1295b-5p	PAR-CLIP	23592263
MIRT482712	hsa-miR-1912	PAR-CLIP	23592263
MIRT114265	hsa-miR-6746-3p	PAR-CLIP	23592263
MIRT482711	hsa-miR-4257	PAR-CLIP	23592263
MIRT482710	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT482709	hsa-miR-4784	PAR-CLIP	23592263
MIRT482707	hsa-miR-6134	PAR-CLIP	23592263
MIRT482708	hsa-miR-765	PAR-CLIP	23592263
MIRT482706	hsa-miR-4710	PAR-CLIP	23592263
MIRT482705	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT482704	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT482703	hsa-miR-6748-5p	PAR-CLIP	23592263
MIRT482702	hsa-miR-4689	PAR-CLIP	23592263
MIRT482701	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT482700	hsa-miR-1262	PAR-CLIP	23592263
MIRT482699	hsa-miR-4701-3p	PAR-CLIP	23592263
MIRT482697	hsa-miR-6736-5p	PAR-CLIP	23592263
MIRT482698	hsa-miR-4651	PAR-CLIP	23592263
MIRT514560	hsa-miR-548aa	HITS-CLIP	21572407
MIRT514559	hsa-miR-548ap-3p	HITS-CLIP	21572407
MIRT514558	hsa-miR-548t-3p	HITS-CLIP	21572407
MIRT503293	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT707104	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT503292	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT508307	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT508306	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT508305	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT503291	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT503290	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT508304	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT503293	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT503292	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT508307	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT508306	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT508305	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT503291	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT503290	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT508304	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT503293	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT503292	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT503291	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT503290	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT609260	hsa-miR-1910-3p	HITS-CLIP	23824327
MIRT609259	hsa-miR-6511a-5p	HITS-CLIP	23824327
MIRT609258	hsa-miR-4514	HITS-CLIP	23824327
MIRT609257	hsa-miR-4692	HITS-CLIP	23824327
MIRT609256	hsa-miR-4645-5p	HITS-CLIP	23824327
MIRT609255	hsa-miR-4673	HITS-CLIP	23824327
MIRT609254	hsa-miR-6075	HITS-CLIP	23824327
MIRT609260	hsa-miR-1910-3p	HITS-CLIP	23824327
MIRT609259	hsa-miR-6511a-5p	HITS-CLIP	23824327
MIRT609258	hsa-miR-4514	HITS-CLIP	23824327
MIRT609257	hsa-miR-4692	HITS-CLIP	23824327
MIRT609256	hsa-miR-4645-5p	HITS-CLIP	23824327
MIRT609255	hsa-miR-4673	HITS-CLIP	23824327
MIRT609254	hsa-miR-6075	HITS-CLIP	23824327
MIRT609260	hsa-miR-1910-3p	HITS-CLIP	23824327
MIRT609259	hsa-miR-6511a-5p	HITS-CLIP	23824327
MIRT609258	hsa-miR-4514	HITS-CLIP	23824327
MIRT609257	hsa-miR-4692	HITS-CLIP	23824327
MIRT609256	hsa-miR-4645-5p	HITS-CLIP	23824327
MIRT609255	hsa-miR-4673	HITS-CLIP	23824327
MIRT609254	hsa-miR-6075	HITS-CLIP	23824327
MIRT613421	hsa-miR-548an	HITS-CLIP	23824327
MIRT613420	hsa-miR-6768-3p	HITS-CLIP	23824327
MIRT613419	hsa-miR-4484	HITS-CLIP	23824327
MIRT609260	hsa-miR-1910-3p	HITS-CLIP	23824327
MIRT609259	hsa-miR-6511a-5p	HITS-CLIP	23824327
MIRT609258	hsa-miR-4514	HITS-CLIP	23824327
MIRT609257	hsa-miR-4692	HITS-CLIP	23824327
MIRT609256	hsa-miR-4645-5p	HITS-CLIP	23824327
MIRT609255	hsa-miR-4673	HITS-CLIP	23824327
MIRT609254	hsa-miR-6075	HITS-CLIP	23824327
MIRT609260	hsa-miR-1910-3p	HITS-CLIP	23824327
MIRT609259	hsa-miR-6511a-5p	HITS-CLIP	23824327
MIRT609258	hsa-miR-4514	HITS-CLIP	23824327
MIRT609257	hsa-miR-4692	HITS-CLIP	23824327
MIRT609256	hsa-miR-4645-5p	HITS-CLIP	23824327
MIRT609255	hsa-miR-4673	HITS-CLIP	23824327
MIRT609254	hsa-miR-6075	HITS-CLIP	23824327
MIRT514565	hsa-miR-548ac	PAR-CLIP	21572407
MIRT514564	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT514563	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT514562	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT514561	hsa-miR-548z	PAR-CLIP	21572407
MIRT514560	hsa-miR-548aa	PAR-CLIP	21572407
MIRT514559	hsa-miR-548ap-3p	PAR-CLIP	21572407
MIRT514558	hsa-miR-548t-3p	PAR-CLIP	21572407
MIRT503293	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT503292	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508307	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT508306	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT508305	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT503291	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT503290	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508304	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT514565	hsa-miR-548ac	PAR-CLIP	21572407
MIRT514564	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT514563	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT514562	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT514561	hsa-miR-548z	PAR-CLIP	21572407
MIRT514560	hsa-miR-548aa	PAR-CLIP	21572407
MIRT514559	hsa-miR-548ap-3p	PAR-CLIP	21572407
MIRT514558	hsa-miR-548t-3p	PAR-CLIP	21572407
MIRT503292	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508307	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT508306	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT508305	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT503291	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT503290	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508304	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT503293	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT503292	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508307	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT508306	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT508305	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT503291	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT503290	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508304	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT514565	hsa-miR-548ac	PAR-CLIP	23446348
MIRT514564	hsa-miR-548bb-3p	PAR-CLIP	23446348
MIRT514563	hsa-miR-548d-3p	PAR-CLIP	23446348
MIRT514562	hsa-miR-548h-3p	PAR-CLIP	23446348
MIRT514561	hsa-miR-548z	PAR-CLIP	23446348
MIRT514560	hsa-miR-548aa	PAR-CLIP	23446348
MIRT514559	hsa-miR-548ap-3p	PAR-CLIP	23446348
MIRT514558	hsa-miR-548t-3p	PAR-CLIP	23446348
MIRT503293	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT503292	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508307	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT508306	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT508305	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT503291	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT503290	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508304	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT503292	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508307	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT508306	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT508305	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT503291	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT503290	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508304	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT503293	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT503292	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT503291	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT503290	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT482713	hsa-miR-1295b-5p	PAR-CLIP	23592263
MIRT482712	hsa-miR-1912	PAR-CLIP	23592263
MIRT114265	hsa-miR-6746-3p	PAR-CLIP	23592263
MIRT482711	hsa-miR-4257	PAR-CLIP	23592263
MIRT482710	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT482709	hsa-miR-4784	PAR-CLIP	23592263
MIRT482707	hsa-miR-6134	PAR-CLIP	23592263
MIRT482708	hsa-miR-765	PAR-CLIP	23592263
MIRT482706	hsa-miR-4710	PAR-CLIP	23592263
MIRT482705	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT482704	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT482703	hsa-miR-6748-5p	PAR-CLIP	23592263
MIRT482702	hsa-miR-4689	PAR-CLIP	23592263
MIRT482701	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT482700	hsa-miR-1262	PAR-CLIP	23592263
MIRT482699	hsa-miR-4701-3p	PAR-CLIP	23592263
MIRT482697	hsa-miR-6736-5p	PAR-CLIP	23592263
MIRT482698	hsa-miR-4651	PAR-CLIP	23592263
MIRT482713	hsa-miR-1295b-5p	PAR-CLIP	23592263
MIRT482712	hsa-miR-1912	PAR-CLIP	23592263
MIRT114265	hsa-miR-6746-3p	PAR-CLIP	23592263
MIRT482711	hsa-miR-4257	PAR-CLIP	23592263
MIRT482710	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT482709	hsa-miR-4784	PAR-CLIP	23592263
MIRT482707	hsa-miR-6134	PAR-CLIP	23592263
MIRT482708	hsa-miR-765	PAR-CLIP	23592263
MIRT482706	hsa-miR-4710	PAR-CLIP	23592263
MIRT482705	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT482704	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT482703	hsa-miR-6748-5p	PAR-CLIP	23592263
MIRT482702	hsa-miR-4689	PAR-CLIP	23592263
MIRT482701	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT482700	hsa-miR-1262	PAR-CLIP	23592263
MIRT482699	hsa-miR-4701-3p	PAR-CLIP	23592263
MIRT482697	hsa-miR-6736-5p	PAR-CLIP	23592263
MIRT482698	hsa-miR-4651	PAR-CLIP	23592263
MIRT755773	hsa-miR-4796-3p	Luciferase reporter assay, Western blotting, qRT-PCR, in vitro cullelar assays, GFP reporter assay	37460775
MIRT1497320	hsa-miR-1183	CLIP-seq
MIRT1497321	hsa-miR-1197	CLIP-seq
MIRT1497322	hsa-miR-1208	CLIP-seq
MIRT1497323	hsa-miR-125a-5p	CLIP-seq
MIRT1497324	hsa-miR-125b	CLIP-seq
MIRT1497325	hsa-miR-1275	CLIP-seq
MIRT1497326	hsa-miR-1286	CLIP-seq
MIRT1497327	hsa-miR-1288	CLIP-seq
MIRT1497328	hsa-miR-146b-3p	CLIP-seq
MIRT1497329	hsa-miR-1827	CLIP-seq
MIRT1497330	hsa-miR-1915	CLIP-seq
MIRT1497331	hsa-miR-214	CLIP-seq
MIRT1497332	hsa-miR-3144-5p	CLIP-seq
MIRT1497333	hsa-miR-3155	CLIP-seq
MIRT1497334	hsa-miR-3155b	CLIP-seq
MIRT1497335	hsa-miR-3169	CLIP-seq
MIRT1497336	hsa-miR-3173-5p	CLIP-seq
MIRT1497337	hsa-miR-3175	CLIP-seq
MIRT1497338	hsa-miR-3180-5p	CLIP-seq
MIRT1497339	hsa-miR-3185	CLIP-seq
MIRT1497340	hsa-miR-3191	CLIP-seq
MIRT1497341	hsa-miR-3613-5p	CLIP-seq
MIRT1497342	hsa-miR-361-3p	CLIP-seq
MIRT1497343	hsa-miR-3619-5p	CLIP-seq
MIRT1497344	hsa-miR-3677-3p	CLIP-seq
MIRT1497345	hsa-miR-3937	CLIP-seq
MIRT1497346	hsa-miR-3944-5p	CLIP-seq
MIRT1497347	hsa-miR-4251	CLIP-seq
MIRT1497348	hsa-miR-4267	CLIP-seq
MIRT1497349	hsa-miR-4270	CLIP-seq
MIRT1497350	hsa-miR-4291	CLIP-seq
MIRT1497351	hsa-miR-4319	CLIP-seq
MIRT1497352	hsa-miR-4324	CLIP-seq
MIRT1497353	hsa-miR-4441	CLIP-seq
MIRT1497354	hsa-miR-4447	CLIP-seq
MIRT1497355	hsa-miR-4459	CLIP-seq
MIRT1497356	hsa-miR-4472	CLIP-seq
MIRT1497357	hsa-miR-4481	CLIP-seq
MIRT1497358	hsa-miR-4519	CLIP-seq
MIRT1497359	hsa-miR-4525	CLIP-seq
MIRT1497360	hsa-miR-4640-5p	CLIP-seq
MIRT1497361	hsa-miR-4652-5p	CLIP-seq
MIRT1497362	hsa-miR-4655-3p	CLIP-seq
MIRT1497363	hsa-miR-4665-5p	CLIP-seq
MIRT1497364	hsa-miR-4690-5p	CLIP-seq
MIRT1497365	hsa-miR-4722-5p	CLIP-seq
MIRT1497366	hsa-miR-4723-5p	CLIP-seq
MIRT1497367	hsa-miR-4726-3p	CLIP-seq
MIRT1497368	hsa-miR-4726-5p	CLIP-seq
MIRT1497369	hsa-miR-4745-5p	CLIP-seq
MIRT1497370	hsa-miR-4753-5p	CLIP-seq
MIRT1497371	hsa-miR-4758-5p	CLIP-seq
MIRT1497372	hsa-miR-4779	CLIP-seq
MIRT1497373	hsa-miR-484	CLIP-seq
MIRT1497374	hsa-miR-491-5p	CLIP-seq
MIRT1497375	hsa-miR-541	CLIP-seq
MIRT1497376	hsa-miR-564	CLIP-seq
MIRT1497377	hsa-miR-580	CLIP-seq
MIRT1497378	hsa-miR-608	CLIP-seq
MIRT1497379	hsa-miR-625	CLIP-seq
MIRT1497380	hsa-miR-654-5p	CLIP-seq
MIRT1497381	hsa-miR-761	CLIP-seq
MIRT1497382	hsa-miR-766	CLIP-seq
MIRT1497383	hsa-miR-874	CLIP-seq
MIRT1497384	hsa-miR-922	CLIP-seq
MIRT2149779	hsa-miR-1225-3p	CLIP-seq
MIRT2149780	hsa-miR-128	CLIP-seq
MIRT1497326	hsa-miR-1286	CLIP-seq
MIRT1497328	hsa-miR-146b-3p	CLIP-seq
MIRT2149781	hsa-miR-3117-5p	CLIP-seq
MIRT2149782	hsa-miR-3151	CLIP-seq
MIRT1497336	hsa-miR-3173-5p	CLIP-seq
MIRT2149783	hsa-miR-3199	CLIP-seq
MIRT2149784	hsa-miR-3201	CLIP-seq
MIRT2149785	hsa-miR-3612	CLIP-seq
MIRT2149786	hsa-miR-3689d	CLIP-seq
MIRT1497346	hsa-miR-3944-5p	CLIP-seq
MIRT1497347	hsa-miR-4251	CLIP-seq
MIRT2149787	hsa-miR-4302	CLIP-seq
MIRT1497352	hsa-miR-4324	CLIP-seq
MIRT2149788	hsa-miR-4443	CLIP-seq
MIRT1497354	hsa-miR-4447	CLIP-seq
MIRT1497355	hsa-miR-4459	CLIP-seq
MIRT1497356	hsa-miR-4472	CLIP-seq
MIRT1497357	hsa-miR-4481	CLIP-seq
MIRT2149789	hsa-miR-4491	CLIP-seq
MIRT2149790	hsa-miR-4508	CLIP-seq
MIRT2149791	hsa-miR-4515	CLIP-seq
MIRT2149792	hsa-miR-4527	CLIP-seq
MIRT2149793	hsa-miR-4648	CLIP-seq
MIRT2149794	hsa-miR-4654	CLIP-seq
MIRT2149795	hsa-miR-4657	CLIP-seq
MIRT2149796	hsa-miR-4701-5p	CLIP-seq
MIRT1497365	hsa-miR-4722-5p	CLIP-seq
MIRT1497369	hsa-miR-4745-5p	CLIP-seq
MIRT1497371	hsa-miR-4758-5p	CLIP-seq
MIRT2149797	hsa-miR-4769-5p	CLIP-seq
MIRT1497372	hsa-miR-4779	CLIP-seq
MIRT2149798	hsa-miR-4791	CLIP-seq
MIRT1497374	hsa-miR-491-5p	CLIP-seq
MIRT1497375	hsa-miR-541	CLIP-seq
MIRT1497377	hsa-miR-580	CLIP-seq
MIRT2149799	hsa-miR-588	CLIP-seq
MIRT1497378	hsa-miR-608	CLIP-seq
MIRT2149800	hsa-miR-615-3p	CLIP-seq
MIRT2149801	hsa-miR-650	CLIP-seq
MIRT1497380	hsa-miR-654-5p	CLIP-seq
MIRT2149802	hsa-miR-663b	CLIP-seq
MIRT1497330	hsa-miR-1915	CLIP-seq
MIRT2369948	hsa-miR-3160-5p	CLIP-seq
MIRT2149796	hsa-miR-4701-5p	CLIP-seq
MIRT2149799	hsa-miR-588	CLIP-seq
MIRT2149780	hsa-miR-128	CLIP-seq
MIRT2463617	hsa-miR-140-3p	CLIP-seq
MIRT2463618	hsa-miR-2113	CLIP-seq
MIRT2463619	hsa-miR-2682	CLIP-seq
MIRT2463620	hsa-miR-296-5p	CLIP-seq
MIRT2149781	hsa-miR-3117-5p	CLIP-seq
MIRT2149782	hsa-miR-3151	CLIP-seq
MIRT2369948	hsa-miR-3160-5p	CLIP-seq
MIRT2149784	hsa-miR-3201	CLIP-seq
MIRT2149786	hsa-miR-3689d	CLIP-seq
MIRT2463621	hsa-miR-3714	CLIP-seq
MIRT2463622	hsa-miR-4265	CLIP-seq
MIRT2463623	hsa-miR-4296	CLIP-seq
MIRT2149787	hsa-miR-4302	CLIP-seq
MIRT2463624	hsa-miR-4322	CLIP-seq
MIRT1497354	hsa-miR-4447	CLIP-seq
MIRT1497356	hsa-miR-4472	CLIP-seq
MIRT2463625	hsa-miR-449c	CLIP-seq
MIRT2149794	hsa-miR-4654	CLIP-seq
MIRT2463626	hsa-miR-4670-3p	CLIP-seq
MIRT2149797	hsa-miR-4769-5p	CLIP-seq
MIRT2149798	hsa-miR-4791	CLIP-seq
MIRT2463627	hsa-miR-486-3p	CLIP-seq
MIRT1497374	hsa-miR-491-5p	CLIP-seq
MIRT2463628	hsa-miR-515-5p	CLIP-seq
MIRT1497375	hsa-miR-541	CLIP-seq
MIRT1497380	hsa-miR-654-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000400	Function	Four-way junction DNA binding	IBA
GO:0000400	Function	Four-way junction DNA binding	IDA	20207730
GO:0000722	Process	Telomere maintenance via recombination	IBA
GO:0000722	Process	Telomere maintenance via recombination	IMP	15507207
GO:0000724	Process	Double-strand break repair via homologous recombination	IMP	23149936
GO:0000781	Component	Chromosome, telomeric region	IC	15507207
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	9469824, 9660962, 11751635, 11842113, 21965664, 24005329, 24141787, 26496610, 28864920, 34591612
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	16215984, 26323318
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005657	Component	Replication fork	IBA
GO:0005657	Component	Replication fork	IDA	20207730
GO:0005737	Component	Cytoplasm	IDA	16215984
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	20413593
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	IGI	10422536
GO:0006281	Process	DNA repair	TAS	9660962
GO:0006310	Process	DNA recombination	IEA
GO:0006310	Process	DNA recombination	TAS	9660962
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	TAS	7603995
GO:0008821	Function	Crossover junction DNA endonuclease activity	IMP	14716019, 23108668
GO:0010824	Process	Regulation of centrosome duplication	IMP	23108668
GO:0033065	Component	Rad51C-XRCC3 complex	IBA
GO:0033065	Component	Rad51C-XRCC3 complex	IDA	11751635
GO:0036297	Process	Interstrand cross-link repair	IMP	26323318
GO:0045003	Process	Double-strand break repair via synthesis-dependent strand annealing	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	16215984
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0071140	Process	Resolution of mitotic recombination intermediates	IBA
GO:0071140	Process	Resolution of mitotic recombination intermediates	IMP	23108668
GO:0090267	Process	Positive regulation of mitotic cell cycle spindle assembly checkpoint	IMP	23108668
GO:0090656	Process	T-circle formation	IBA
GO:0090656	Process	T-circle formation	IC	15507207
GO:0090656	Process	T-circle formation	IMP	21903669
GO:0090657	Process	Telomeric loop disassembly	TAS	27918544
GO:0090737	Process	Telomere maintenance via telomere trimming	IGI	27918544
GO:0140664	Function	ATP-dependent DNA damage sensor activity	IEA

Other IDs

• MIM: 600675
• HGNC: 12830
• e!Ensembl: ENSG00000126215

Protein

• UniProt ID: O43542
• Protein name: DNA repair protein XRCC3 (X-ray repair cross-complementing protein 3)
• Protein function: Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA, thought to repair chromosomal fragmentation, translocations and deletions. Part of the RAD51 paralog protein complex CX3 which acts in the BRCA1-BRCA2-dependen
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08423	Rad51	52 → 340	Rad51	Domain

• Sequence:

  MDLDLLDLNPRIIAAIKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLLRTASLHLRGS
  SILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQL
  CLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDVPGELLQKLRFGSQIF
  IEHVADVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAPRARHLQSLGA
  TLRELSSAFQSPVLCINQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADR
  LREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH

• Sequence length: 346

Pathways

KEGG:

Homologous recombination

Reactome:

HDR through Homologous Recombination (HRR)
Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)
Resolution of D-loop Structures through Holliday Junction Intermediates
Homologous DNA Pairing and Strand Exchange

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Breast cancer, susceptibility to	risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, BASAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA, CUTANEOUS MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma, cutaneous malignant, susceptibility to, 6	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
XRCC3-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	25176580		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15333465, 21937297		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18582155		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	16571649		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	16540687		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	18582155		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	15767338, 16542436		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	22370935	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	36835215	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30150425		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	30150425	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	22370935, 27852033		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	22370935	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	34628594	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	12223443, 14652287, 16652373, 18630471, 19414392, 19429237, 19815090, 20500515, 20947146, 21617942, 22299591, 23562721, 24085356, 24104500, 27153553		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	18365755		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	18330515, 24061639		★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	17063276		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12023982, 12565173, 14578164, 14652281, 15066914, 15066923, 15734952, 15784178, 16002061, 16214912, 16485136, 16791138, 16963196, 17063276, 17063279, 17116943, 17701750, 18188695, 18551366, 18701435, 19426727, 19789975, 20004634, 20049524, 20054644, 20140625, 20331623, 21283680, 21701125, 21725594, 22161248, 22544576, 23562721, 24642895, 24933103, 25169497, 25340946, 25556451, 26446325, 26498491, 26543082, 26881229, 28315507, 28983784, 29255180, 29332455, 31077156		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	12023982		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18551366, 18701435, 21283680, 21701125, 21749698, 22864780, 24139550, 24642895, 25556451, 26446325, 26881229, 27571987, 28315507, 28864920, 28983784, 29332455, 31905201, 32295201, 35061678, 35691022, 37774058	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	23977219, 35691022	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	28983784	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	32295201	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Head	Neoplasm of head	CTD_human_DG	22613844		★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	20334523		★☆☆☆☆ Found in Text Mining only
Cancer of Neck	Neck Cancer	CTD_human_DG	22613844		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21283680, 26918347, 29895130	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16542436, 22775506, 30033552		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22691054, 24307625, 25337275, 29085212, 29895130, 32258128	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	12223443, 14652287, 16652373, 18630471, 19414392, 19429237, 19815090, 20500515, 20947146, 21617942, 22299591, 23562721, 24085356, 24104500, 27153553		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	25510985		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12618330, 14534887, 15312685, 15333465, 17034901, 17705814, 18990748, 19031937, 20500515, 21198260, 22525558, 23289442, 23300009, 23409158, 23443124, 23526128, 23562721, 23749486, 23982880, 23990458, 23990873, 25066399, 25501160, 26124335, 27819744, 31446980, 31584889		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26682510	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23443124	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	15126335, 16501254, 18067130, 24454720, 25218703		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma, Basal Cell	Carcinoma	CTD_human_DG	16501254		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15734952, 15924337, 22544576, 22938418, 24139550, 24254304, 24615029, 25006581, 26801223, 29255180		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21790234, 23539294, 24377592, 28708208		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19096231, 21790234, 23539294, 24377592, 28708208		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22752646		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	21035470	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	25247297	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26023803		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	21561390		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12865926, 15354414, 15679883, 15914278, 16271954, 17191090, 19031937, 19915856, 21104022, 22524842, 23271134, 23504553, 24687779, 25520078, 25824748, 26600544, 29394274, 31350979		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12865926, 15679883, 19031937, 21104022, 22524842, 23894404, 24166604, 25520078, 26023803, 28453695, 29394274, 31350979	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15354414, 15679883, 16271954, 19031937		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19031937	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	14729591, 15470755, 15471094, 15971256, 16997330, 17019047, 17114795, 17662313, 17923529, 19481674, 20708982, 22370935		★☆☆☆☆ Found in Text Mining only
Conjunctivitis	Conjunctivitis	Pubtator	21035470	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26682510		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23368530, 24315498		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	11059748, 20601096, 23562721, 24454720, 26922354		★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	15933498, 21414327, 23022340, 24377596, 26938431		★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	23793614		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22271435, 22487057		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	20391347		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	20391347	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	20391347, 24615029	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	15924337		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	21347786, 27590853		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	21347786, 27590853		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	21347786		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26383967	Associate	★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	21035470	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	1303209, 31584931		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	31584931	Associate	★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	31584931		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	26254358		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	16425350	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	27460091, 29206199	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	29206199		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	18046624		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22370935, 26511493, 29574277		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22370935	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22370935, 26511493, 29574277		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	18330515, 19330829, 23244079, 23803098, 23918307, 23991984, 24186073, 24500421, 24633885, 26400288, 26843108, 29574277		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23244079, 23534771, 26400288	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	16030112, 20804747, 22613844, 23244135, 25556492		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	12115490		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Neoplasms	Head And Neck Neoplasms	CTD_human_DG	22613844		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	25556492, 37774056	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head Neoplasms	Head Neoplasms	CTD_human_DG	22613844		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	22868256	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	24139550, 29255180	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	21347786		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	19280628		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	19280628, 21374732	Stimulate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	19280628	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	29626209		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	16308313, 24197983, 24304418		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	12393447, 21951951	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12393447		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15102670, 17197435, 21296419, 21725251, 21951951, 23397959, 23747401, 23978154, 24197983		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	18410587, 22775506, 24922659, 25556470, 31452804		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18504145, 22691054, 23044807, 23558966, 23824570, 23873110, 24307625, 25337275, 26662391, 27306318		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18504145		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	14534887, 17705814, 18990748, 23409158, 23443124, 26159902, 26918347	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18852222, 24395651		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22864780, 24728564	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	22524835		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	22524835	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	25178586	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	16492913, 25178586		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	LHGDN	16492913		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	16030112, 20804747, 22613844, 23244135, 25556492		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	CTD_human_DG	22613844		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12023982, 12565173, 14578164, 14652281, 15066914, 15066923, 15734952, 15784178, 16002061, 16214912, 16485136, 16791138, 16963196, 17063276, 17063279, 17116943, 17701750, 18188695, 18551366, 18701435, 18752184, 19426727, 19789975, 20004634, 20049524, 20054644, 20140625, 20331623, 21283680, 21701125, 21725594, 22161248, 22544576, 23562721, 24642895, 24933103, 25169497, 25340946, 25556451, 26446325, 26498491, 26543082, 26881229, 28315507, 28983784, 29255180, 29332455, 31077156		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	12023982		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	22271435, 22487057		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	21347786, 27590853		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	21347786		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	24523020, 25510985		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	23044807		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12618330, 15312685, 15333465, 17034901, 17705814, 18990748, 19031937, 20500515, 21198260, 22525558, 23289442, 23300009, 23409158, 23443124, 23526128, 23562721, 23749486, 23982880, 23990458, 23990873, 25066399, 25501160, 26124335, 27819744, 31446980, 31584889		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	18410587, 22775506, 24922659, 25556470, 31452804		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	20334523		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15734952, 22544576, 22938418, 24139550, 24254304, 24615029, 25006581, 26801223, 29255180, 30551670		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17986315, 18559563		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pharynx	Malignant Pharyngeal Neoplasm	BEFREE	15386379		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18582155, 19914098, 20590474, 23075580, 26339569		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	11059748, 16501254		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	15126335, 24454720, 25218703		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15019159, 16425350, 20549576, 20817763, 24197974, 24315014, 25428673, 25642794, 25973083, 28415781		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	21347786		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	19772428, 24277376, 26045834, 26687776, 26938431, 28490032		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	12223443, 14652287, 16652373, 18630471, 19414392, 19429237, 19815090, 20500515, 20947146, 21617942, 22299591, 23562721, 24085356, 24104500, 27153553		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12668615, 15159313, 15354414, 15386379, 16137195, 16271954, 16475125, 16501254, 16505003, 16707649, 16791138, 17705814, 18511875, 18824251, 20500515, 23562721, 24104500, 24197973, 24277376, 24315014, 24377592, 24454720, 24728564, 25169497, 25428673, 25510985, 25556492, 25687493, 26446325, 26682510, 27639382, 31584931		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	16369171		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21790234, 23539294, 24377592, 28708208		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26023803		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	12023982		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	12023982		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12565173, 12815008, 16791138, 17063279, 17116943, 17701750		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	12023982		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	15009726		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11059748, 15009726, 20601096, 24454720, 26922354		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	11059748		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	12376526		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	15009726	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	BEFREE	18330515, 23534771		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	23534771	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	CTD_human_DG	16564556		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma Malignant	Mesothelioma	Pubtator	22982660	Associate	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	24892639		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	18579371	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	18410587		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	22726897, 37006067	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	36149156	Stimulate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	25154760		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	18712175		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	18712175	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	17630853, 20334523, 24453273, 25687493, 27639382		★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	CTD_human_DG	22613844		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15354414, 22370935, 23549037, 24454720, 26682510, 28639054, 30712190		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	21035470	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	28033528	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	21035470	Associate	★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	15009726		★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	14688016, 18771529		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16407418, 21188533, 22374424, 22511383, 22551904, 23167352, 23924833, 23940523, 24116196, 24737519, 24933103, 26159902, 27248474, 28717179		★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	28623401		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	22092501		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26617908, 26662447, 30539867		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	26617908, 30539867	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	26801223		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15734952, 22544576, 22938418, 24139550, 24254304, 24615029, 25006581, 26801223, 29255180		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22938418, 24615029, 29255180, 30712190, 37344587	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30712190	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17986315, 18559563		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	17986315, 18559563		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16540687, 17986315	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	26264616		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22224629		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	21035470	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18582155, 19914098, 20590474, 23075580, 26339569		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26339569, 36494413, 36969741	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24053728	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	20229274		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	26554302		★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	16791138, 24454720, 25218703		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	21035470	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	11059748, 16501254		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin Neoplasms	LHGDN	16791138		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	17063276, 21701125		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12115490		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15126335, 24454720, 25218703, 26742000, 30033552		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	18046624, 26383967		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26505394, 27683114, 35390246	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	23443124		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	12115490, 18768166, 20804747, 21419115, 21704413, 22284908, 22427030, 26001739, 27683114		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15019159, 16425350, 20549576, 20817763, 24197974, 24315014, 25428673, 25642794, 25973083, 28415781		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16425350, 25428673, 25542228, 28415781	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	21347786		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomatitis	Stomatitis	BEFREE	28623401		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26264616, 28490032	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	19772428, 24277376, 26045834, 26687776, 26938431, 28490032		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	15933498		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	19772428, 24277376, 26045834, 26687776, 26938431, 28490032		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	24377596	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	24377596, 26045834, 26938431, 28490032	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24728564, 26543082		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24728564	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	25247297		★☆☆☆☆ Found in Text Mining only
Upper Aerodigestive Tract Neoplasms	Upper Aerodigestive Tract Neoplasms	CTD_human_DG	22613844		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	17898541, 18630471, 19414392, 19429237, 27153553, 29267235	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27153553	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	BEFREE	24675091		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21790234, 23539294, 24377592, 28708208, 35996502	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	10565301, 26254358		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	16284380, 17476281, 24892639		★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	14688016, 15878910		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum, Complementation Group D	Xeroderma Pigmentosum	BEFREE	12618330, 16407418, 16707649, 17549067, 17630853, 19096231, 19307510, 22374424, 24619222, 24687779, 24955348, 26554302		★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group A	Xeroderma Pigmentosum	BEFREE	15333465		★☆☆☆☆ Found in Text Mining only