Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	7511
Gene name	X-prolyl aminopeptidase 1
Gene symbol	XPNPEP1
Synonyms (NCBI Gene)	APP1SAMPXPNPEPXPNPEPLXPNPEPL1
Chromosome	10
Chromosome location	10q25.1
Summary	This gene encodes the cytosolic form of a metalloaminopeptidase that catalyzes the cleavage of the N-terminal amino acid adjacent to a proline residue. The gene product may play a role in degradation and maturation of tachykinins, neuropeptides, and pepti

170

Show/Hide all (170)

miRTarBase ID	miRNA	Experiments	Reference
MIRT439278	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT439278	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT1496159	hsa-miR-1185	CLIP-seq
MIRT1496160	hsa-miR-2116	CLIP-seq
MIRT1496161	hsa-miR-3163	CLIP-seq
MIRT1496162	hsa-miR-3653	CLIP-seq
MIRT1496163	hsa-miR-3659	CLIP-seq
MIRT1496164	hsa-miR-3679-5p	CLIP-seq
MIRT1496165	hsa-miR-4509	CLIP-seq
MIRT1496166	hsa-miR-450b-5p	CLIP-seq
MIRT1496167	hsa-miR-4652-3p	CLIP-seq
MIRT1496168	hsa-miR-4658	CLIP-seq
MIRT1496169	hsa-miR-4659a-3p	CLIP-seq
MIRT1496170	hsa-miR-4659b-3p	CLIP-seq
MIRT1496171	hsa-miR-4677-5p	CLIP-seq
MIRT1496172	hsa-miR-4691-5p	CLIP-seq
MIRT1496173	hsa-miR-4699-5p	CLIP-seq
MIRT1496174	hsa-miR-4744	CLIP-seq
MIRT1496175	hsa-miR-4778-3p	CLIP-seq
MIRT1496176	hsa-miR-520a-5p	CLIP-seq
MIRT1496177	hsa-miR-520d-5p	CLIP-seq
MIRT1496178	hsa-miR-524-5p	CLIP-seq
MIRT1496179	hsa-miR-525-5p	CLIP-seq
MIRT1496180	hsa-miR-548a-5p	CLIP-seq
MIRT1496181	hsa-miR-548ab	CLIP-seq
MIRT1496182	hsa-miR-548ak	CLIP-seq
MIRT1496183	hsa-miR-548b-5p	CLIP-seq
MIRT1496184	hsa-miR-548c-5p	CLIP-seq
MIRT1496185	hsa-miR-548d-5p	CLIP-seq
MIRT1496186	hsa-miR-548h	CLIP-seq
MIRT1496187	hsa-miR-548i	CLIP-seq
MIRT1496188	hsa-miR-548j	CLIP-seq
MIRT1496189	hsa-miR-548k	CLIP-seq
MIRT1496190	hsa-miR-548l	CLIP-seq
MIRT1496191	hsa-miR-548w	CLIP-seq
MIRT1496192	hsa-miR-548y	CLIP-seq
MIRT1496193	hsa-miR-559	CLIP-seq
MIRT1496194	hsa-miR-574-5p	CLIP-seq
MIRT1496195	hsa-miR-583	CLIP-seq
MIRT1496196	hsa-miR-103a	CLIP-seq
MIRT1496197	hsa-miR-107	CLIP-seq
MIRT1496198	hsa-miR-1237	CLIP-seq
MIRT1496199	hsa-miR-1248	CLIP-seq
MIRT1496200	hsa-miR-197	CLIP-seq
MIRT1496201	hsa-miR-3126-5p	CLIP-seq
MIRT1496202	hsa-miR-3944-5p	CLIP-seq
MIRT1496203	hsa-miR-4255	CLIP-seq
MIRT1496204	hsa-miR-4299	CLIP-seq
MIRT1496205	hsa-miR-4443	CLIP-seq
MIRT1496206	hsa-miR-4456	CLIP-seq
MIRT1496207	hsa-miR-4667-3p	CLIP-seq
MIRT1496208	hsa-miR-5096	CLIP-seq
MIRT1496209	hsa-miR-548q	CLIP-seq
MIRT1496210	hsa-miR-590-3p	CLIP-seq
MIRT2369821	hsa-miR-3667-3p	CLIP-seq
MIRT1496169	hsa-miR-4659a-3p	CLIP-seq
MIRT1496170	hsa-miR-4659b-3p	CLIP-seq
MIRT1496172	hsa-miR-4691-5p	CLIP-seq
MIRT1496176	hsa-miR-520a-5p	CLIP-seq
MIRT1496179	hsa-miR-525-5p	CLIP-seq
MIRT1496196	hsa-miR-103a	CLIP-seq
MIRT1496197	hsa-miR-107	CLIP-seq
MIRT1496198	hsa-miR-1237	CLIP-seq
MIRT1496199	hsa-miR-1248	CLIP-seq
MIRT2663460	hsa-miR-18a	CLIP-seq
MIRT2663461	hsa-miR-18b	CLIP-seq
MIRT2663462	hsa-miR-193a-3p	CLIP-seq
MIRT2663463	hsa-miR-193b	CLIP-seq
MIRT1496200	hsa-miR-197	CLIP-seq
MIRT2663464	hsa-miR-202	CLIP-seq
MIRT2663465	hsa-miR-2117	CLIP-seq
MIRT2663466	hsa-miR-2355-5p	CLIP-seq
MIRT2663467	hsa-miR-2681	CLIP-seq
MIRT2663468	hsa-miR-29a	CLIP-seq
MIRT2663469	hsa-miR-29b	CLIP-seq
MIRT2663470	hsa-miR-29c	CLIP-seq
MIRT2663471	hsa-miR-3065-5p	CLIP-seq
MIRT1496201	hsa-miR-3126-5p	CLIP-seq
MIRT2663472	hsa-miR-3171	CLIP-seq
MIRT2369821	hsa-miR-3667-3p	CLIP-seq
MIRT2663473	hsa-miR-3680	CLIP-seq
MIRT2663474	hsa-miR-3926	CLIP-seq
MIRT1496202	hsa-miR-3944-5p	CLIP-seq
MIRT1496203	hsa-miR-4255	CLIP-seq
MIRT2663475	hsa-miR-4273	CLIP-seq
MIRT1496204	hsa-miR-4299	CLIP-seq
MIRT2663476	hsa-miR-4420	CLIP-seq
MIRT1496205	hsa-miR-4443	CLIP-seq
MIRT1496206	hsa-miR-4456	CLIP-seq
MIRT2663477	hsa-miR-4474-5p	CLIP-seq
MIRT2663478	hsa-miR-4499	CLIP-seq
MIRT2663479	hsa-miR-4508	CLIP-seq
MIRT2663480	hsa-miR-4655-5p	CLIP-seq
MIRT1496169	hsa-miR-4659a-3p	CLIP-seq
MIRT1496170	hsa-miR-4659b-3p	CLIP-seq
MIRT2663481	hsa-miR-4661-5p	CLIP-seq
MIRT1496207	hsa-miR-4667-3p	CLIP-seq
MIRT1496171	hsa-miR-4677-5p	CLIP-seq
MIRT2663482	hsa-miR-4678	CLIP-seq
MIRT1496172	hsa-miR-4691-5p	CLIP-seq
MIRT2663483	hsa-miR-4735-3p	CLIP-seq
MIRT2663484	hsa-miR-490-5p	CLIP-seq
MIRT1496208	hsa-miR-5096	CLIP-seq
MIRT2663485	hsa-miR-513c	CLIP-seq
MIRT2663486	hsa-miR-514b-5p	CLIP-seq
MIRT1496176	hsa-miR-520a-5p	CLIP-seq
MIRT1496177	hsa-miR-520d-5p	CLIP-seq
MIRT1496178	hsa-miR-524-5p	CLIP-seq
MIRT1496179	hsa-miR-525-5p	CLIP-seq
MIRT2663487	hsa-miR-548c-3p	CLIP-seq
MIRT1496209	hsa-miR-548q	CLIP-seq
MIRT2663488	hsa-miR-548s	CLIP-seq
MIRT2663489	hsa-miR-548u	CLIP-seq
MIRT1496210	hsa-miR-590-3p	CLIP-seq
MIRT2663490	hsa-miR-591	CLIP-seq
MIRT2663491	hsa-miR-619	CLIP-seq
MIRT1496196	hsa-miR-103a	CLIP-seq
MIRT1496197	hsa-miR-107	CLIP-seq
MIRT1496198	hsa-miR-1237	CLIP-seq
MIRT1496199	hsa-miR-1248	CLIP-seq
MIRT2663460	hsa-miR-18a	CLIP-seq
MIRT2663461	hsa-miR-18b	CLIP-seq
MIRT2663462	hsa-miR-193a-3p	CLIP-seq
MIRT2663463	hsa-miR-193b	CLIP-seq
MIRT1496200	hsa-miR-197	CLIP-seq
MIRT2663464	hsa-miR-202	CLIP-seq
MIRT2663465	hsa-miR-2117	CLIP-seq
MIRT2663466	hsa-miR-2355-5p	CLIP-seq
MIRT2663467	hsa-miR-2681	CLIP-seq
MIRT2663468	hsa-miR-29a	CLIP-seq
MIRT2663469	hsa-miR-29b	CLIP-seq
MIRT2663470	hsa-miR-29c	CLIP-seq
MIRT2663471	hsa-miR-3065-5p	CLIP-seq
MIRT1496201	hsa-miR-3126-5p	CLIP-seq
MIRT2663472	hsa-miR-3171	CLIP-seq
MIRT2369821	hsa-miR-3667-3p	CLIP-seq
MIRT2663473	hsa-miR-3680	CLIP-seq
MIRT2663474	hsa-miR-3926	CLIP-seq
MIRT1496202	hsa-miR-3944-5p	CLIP-seq
MIRT1496203	hsa-miR-4255	CLIP-seq
MIRT2663475	hsa-miR-4273	CLIP-seq
MIRT1496204	hsa-miR-4299	CLIP-seq
MIRT2663476	hsa-miR-4420	CLIP-seq
MIRT1496205	hsa-miR-4443	CLIP-seq
MIRT1496206	hsa-miR-4456	CLIP-seq
MIRT2663477	hsa-miR-4474-5p	CLIP-seq
MIRT2663479	hsa-miR-4508	CLIP-seq
MIRT2663480	hsa-miR-4655-5p	CLIP-seq
MIRT1496169	hsa-miR-4659a-3p	CLIP-seq
MIRT1496170	hsa-miR-4659b-3p	CLIP-seq
MIRT2663481	hsa-miR-4661-5p	CLIP-seq
MIRT1496207	hsa-miR-4667-3p	CLIP-seq
MIRT1496171	hsa-miR-4677-5p	CLIP-seq
MIRT2663482	hsa-miR-4678	CLIP-seq
MIRT1496172	hsa-miR-4691-5p	CLIP-seq
MIRT2663483	hsa-miR-4735-3p	CLIP-seq
MIRT2663484	hsa-miR-490-5p	CLIP-seq
MIRT1496208	hsa-miR-5096	CLIP-seq
MIRT2663485	hsa-miR-513c	CLIP-seq
MIRT2663486	hsa-miR-514b-5p	CLIP-seq
MIRT1496176	hsa-miR-520a-5p	CLIP-seq
MIRT1496177	hsa-miR-520d-5p	CLIP-seq
MIRT1496178	hsa-miR-524-5p	CLIP-seq
MIRT1496179	hsa-miR-525-5p	CLIP-seq
MIRT2663487	hsa-miR-548c-3p	CLIP-seq
MIRT1496209	hsa-miR-548q	CLIP-seq
MIRT2663488	hsa-miR-548s	CLIP-seq
MIRT1496210	hsa-miR-590-3p	CLIP-seq
MIRT2663490	hsa-miR-591	CLIP-seq
MIRT2663491	hsa-miR-619	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004177	Function	Aminopeptidase activity	IDA	11106490
GO:0004177	Function	Aminopeptidase activity	IEA
GO:0004177	Function	Aminopeptidase activity	TAS	9465902
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IDA	11106490
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0006508	Process	Proteolysis	IDA	11106490
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0010815	Process	Bradykinin catabolic process	IDA	18515364
GO:0016787	Function	Hydrolase activity	IEA
GO:0030145	Function	Manganese ion binding	IDA	18515364
GO:0042803	Function	Protein homodimerization activity	IPI	18515364
GO:0043069	Process	Negative regulation of programmed cell death	IDA	35165443
GO:0046872	Function	Metal ion binding	IEA
GO:0070006	Function	Metalloaminopeptidase activity	IDA	18515364, 35165443
GO:0070006	Function	Metalloaminopeptidase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0140633	Process	CARD8 inflammasome complex assembly	IDA	33053349

MIM	HGNC	e!Ensembl
602443	12822	ENSG00000108039

Q9NQW7

Protein name

Xaa-Pro aminopeptidase 1 (EC 3.4.11.9) (Aminoacylproline aminopeptidase) (Cytosolic aminopeptidase P) (Soluble aminopeptidase P) (sAmp) (X-Pro aminopeptidase 1) (X-prolyl aminopeptidase 1, soluble)

Protein function

Metalloaminopeptidase that catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro (PubMed:11106490, PubMed:18515364, PubMed:35165443). Contributes to the degradation of bradykinin (PubMed:111064

PDB

3CTZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01321	Creatinase_N	10 → 154	Creatinase/Prolidase N-terminal domain	Domain
PF16189	Creatinase_N_2	157 → 326		Domain
PF00557	Peptidase_M24	328 → 544	Metallopeptidase family M24	Domain
PF16188	Peptidase_M24_C	555 → 619	C-terminal region of peptidase_M24	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues tested, including pancreas, heart, muscle, kidney, liver, lung and brain. Highest levels in pancreas. {ECO:0000269|PubMed:9465902}.

Sequence

MPPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSA
GTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVD
PLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKD
KVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGD
RIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSE
TIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEI
SAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQY
KDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSG
LDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVV
LVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKEL
QKQGRQEALEWLIRETQPISKQH

Sequence length

623

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	10021369, 24722208, 26446838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	12900421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33482886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	20460270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	24104524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	28072414	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	12057910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	25586835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29911253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29019858, 31843928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	12057910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	24104524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29245961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	15685547, 31843928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	10666673, 15255950, 16432153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29911253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25734857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25105437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28435529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	12900421	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11238715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	16714280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	16432153		★★★★★ ★☆☆☆☆ Found in Text Mining only

XPNPEP1 (X-prolyl aminopeptidase 1)