Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7494
Gene name	X-box binding protein 1
Gene symbol	XBP1
Synonyms (NCBI Gene)	TREB-5TREB5XBP-1XBP2
Chromosome	22
Chromosome location	22q12.1\|22q12
Summary	This gene encodes a transcription factor that regulates MHC class II genes by binding to a promoter element referred to as an X box. This gene product is a bZIP protein, which was also identified as a cellular transcription factor that binds to an enhance

412

Show/Hide all (412)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004462	hsa-miR-127-3p	Luciferase reporter assay	19530237
MIRT006375	hsa-miR-214-3p	ELISAFlowLuciferase reporter assayqRT-PCRWestern blot	22359598
MIRT006375	hsa-miR-214-3p	ELISAFlowLuciferase reporter assayqRT-PCRWestern blot	22359598
MIRT006375	hsa-miR-214-3p	ELISAFlowLuciferase reporter assayqRT-PCRWestern blot	22359598
MIRT006375	hsa-miR-214-3p	ELISAFlowLuciferase reporter assayqRT-PCRWestern blot	22359598
MIRT006375	hsa-miR-214-3p	ELISAFlowLuciferase reporter assayqRT-PCRWestern blot	22359598
MIRT006375	hsa-miR-214-3p	ELISAFlowLuciferase reporter assayqRT-PCRWestern blot	22359598
MIRT022880	hsa-miR-124-3p	Microarray	18668037
MIRT048823	hsa-miR-93-5p	CLASH	23622248
MIRT044687	hsa-miR-320a	CLASH	23622248
MIRT037784	hsa-miR-625-3p	CLASH	23622248
MIRT439138	hsa-let-7c-5p	3'LIFE	25074381
MIRT439138	hsa-let-7c-5p	3'LIFE	25074381
MIRT731734	hsa-miR-30a-3p	Luciferase reporter assayqRT-PCR	26572862
MIRT731734	hsa-miR-30a-3p	Luciferase reporter assayqRT-PCR	26572862
MIRT044687	hsa-miR-320a	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCRFlow cytometryImmunocytochemistry (ICC)	34112145
MIRT735003	hsa-miR-34a-5p	Luciferase reporter assayWestern blottingNorthern blottingqRT-PCR	32531952
MIRT735436	hsa-miR-330-3p	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	32386518
MIRT1495169	hsa-miR-1225-3p	CLIP-seq
MIRT1495170	hsa-miR-1251	CLIP-seq
MIRT1495171	hsa-miR-1269	CLIP-seq
MIRT1495172	hsa-miR-1269b	CLIP-seq
MIRT1495173	hsa-miR-1276	CLIP-seq
MIRT1495174	hsa-miR-1287	CLIP-seq
MIRT1495175	hsa-miR-1288	CLIP-seq
MIRT1495176	hsa-miR-1324	CLIP-seq
MIRT1495177	hsa-miR-144	CLIP-seq
MIRT1495178	hsa-miR-145	CLIP-seq
MIRT1495179	hsa-miR-186	CLIP-seq
MIRT1495180	hsa-miR-2054	CLIP-seq
MIRT1495181	hsa-miR-214	CLIP-seq
MIRT1495182	hsa-miR-2682	CLIP-seq
MIRT1495183	hsa-miR-302f	CLIP-seq
MIRT1495184	hsa-miR-3117-3p	CLIP-seq
MIRT1495185	hsa-miR-3119	CLIP-seq
MIRT1495186	hsa-miR-3121-3p	CLIP-seq
MIRT1495187	hsa-miR-3125	CLIP-seq
MIRT1495188	hsa-miR-3126-5p	CLIP-seq
MIRT1495189	hsa-miR-3132	CLIP-seq
MIRT1495190	hsa-miR-3133	CLIP-seq
MIRT1495191	hsa-miR-3135b	CLIP-seq
MIRT1495192	hsa-miR-3148	CLIP-seq
MIRT1495193	hsa-miR-3153	CLIP-seq
MIRT1495194	hsa-miR-3168	CLIP-seq
MIRT1495195	hsa-miR-3169	CLIP-seq
MIRT1495196	hsa-miR-3200-3p	CLIP-seq
MIRT1495197	hsa-miR-320b	CLIP-seq
MIRT1495198	hsa-miR-320d	CLIP-seq
MIRT1495199	hsa-miR-33a	CLIP-seq
MIRT1495200	hsa-miR-33b	CLIP-seq
MIRT1495201	hsa-miR-34a	CLIP-seq
MIRT1495202	hsa-miR-34c-5p	CLIP-seq
MIRT1495203	hsa-miR-3612	CLIP-seq
MIRT1495204	hsa-miR-3616-5p	CLIP-seq
MIRT1495205	hsa-miR-3617	CLIP-seq
MIRT1495206	hsa-miR-3618	CLIP-seq
MIRT1495207	hsa-miR-3619-5p	CLIP-seq
MIRT1495208	hsa-miR-3647-5p	CLIP-seq
MIRT1495209	hsa-miR-3665	CLIP-seq
MIRT1495210	hsa-miR-3682-5p	CLIP-seq
MIRT1495211	hsa-miR-376c	CLIP-seq
MIRT1495212	hsa-miR-3916	CLIP-seq
MIRT1495213	hsa-miR-3934	CLIP-seq
MIRT1495214	hsa-miR-3942-3p	CLIP-seq
MIRT1495215	hsa-miR-3943	CLIP-seq
MIRT1495216	hsa-miR-4271	CLIP-seq
MIRT1495217	hsa-miR-4275	CLIP-seq
MIRT1495218	hsa-miR-4291	CLIP-seq
MIRT1495219	hsa-miR-4313	CLIP-seq
MIRT1495220	hsa-miR-4419a	CLIP-seq
MIRT1495221	hsa-miR-4429	CLIP-seq
MIRT1495222	hsa-miR-4434	CLIP-seq
MIRT1495223	hsa-miR-4438	CLIP-seq
MIRT1495224	hsa-miR-4443	CLIP-seq
MIRT1495225	hsa-miR-449a	CLIP-seq
MIRT1495226	hsa-miR-449b	CLIP-seq
MIRT1495227	hsa-miR-449c	CLIP-seq
MIRT1495228	hsa-miR-4509	CLIP-seq
MIRT1495229	hsa-miR-4510	CLIP-seq
MIRT1495230	hsa-miR-4514	CLIP-seq
MIRT1495231	hsa-miR-4515	CLIP-seq
MIRT1495232	hsa-miR-4516	CLIP-seq
MIRT1495233	hsa-miR-4517	CLIP-seq
MIRT1495234	hsa-miR-4529-3p	CLIP-seq
MIRT1495235	hsa-miR-4531	CLIP-seq
MIRT1495236	hsa-miR-4539	CLIP-seq
MIRT1495237	hsa-miR-4635	CLIP-seq
MIRT1495238	hsa-miR-4645-5p	CLIP-seq
MIRT1495239	hsa-miR-4673	CLIP-seq
MIRT1495240	hsa-miR-4684-5p	CLIP-seq
MIRT1495241	hsa-miR-4690-5p	CLIP-seq
MIRT1495242	hsa-miR-4691-5p	CLIP-seq
MIRT1495243	hsa-miR-4692	CLIP-seq
MIRT1495244	hsa-miR-4694-3p	CLIP-seq
MIRT1495245	hsa-miR-4703-3p	CLIP-seq
MIRT1495246	hsa-miR-4704-5p	CLIP-seq
MIRT1495247	hsa-miR-4709-5p	CLIP-seq
MIRT1495248	hsa-miR-4712-3p	CLIP-seq
MIRT1495249	hsa-miR-4712-5p	CLIP-seq
MIRT1495250	hsa-miR-4716-3p	CLIP-seq
MIRT1495251	hsa-miR-4716-5p	CLIP-seq
MIRT1495252	hsa-miR-4719	CLIP-seq
MIRT1495253	hsa-miR-4725-3p	CLIP-seq
MIRT1495254	hsa-miR-4740-5p	CLIP-seq
MIRT1495255	hsa-miR-4759	CLIP-seq
MIRT1495256	hsa-miR-4764-5p	CLIP-seq
MIRT1495257	hsa-miR-513a-3p	CLIP-seq
MIRT1495258	hsa-miR-513b	CLIP-seq
MIRT1495259	hsa-miR-513c	CLIP-seq
MIRT1495260	hsa-miR-514b-5p	CLIP-seq
MIRT1495261	hsa-miR-522	CLIP-seq
MIRT1495262	hsa-miR-526b	CLIP-seq
MIRT1495263	hsa-miR-539	CLIP-seq
MIRT1495264	hsa-miR-548a-3p	CLIP-seq
MIRT1495265	hsa-miR-548b-3p	CLIP-seq
MIRT1495266	hsa-miR-548e	CLIP-seq
MIRT1495267	hsa-miR-548f	CLIP-seq
MIRT1495268	hsa-miR-548k	CLIP-seq
MIRT1495269	hsa-miR-548n	CLIP-seq
MIRT1495270	hsa-miR-548t	CLIP-seq
MIRT1495271	hsa-miR-550b	CLIP-seq
MIRT1495272	hsa-miR-573	CLIP-seq
MIRT1495273	hsa-miR-600	CLIP-seq
MIRT1495274	hsa-miR-619	CLIP-seq
MIRT1495275	hsa-miR-625	CLIP-seq
MIRT1495276	hsa-miR-633	CLIP-seq
MIRT1495277	hsa-miR-637	CLIP-seq
MIRT1495278	hsa-miR-641	CLIP-seq
MIRT1495279	hsa-miR-650	CLIP-seq
MIRT1495280	hsa-miR-654-3p	CLIP-seq
MIRT1495281	hsa-miR-761	CLIP-seq
MIRT1495282	hsa-miR-770-5p	CLIP-seq
MIRT1495283	hsa-miR-877	CLIP-seq
MIRT1495284	hsa-miR-922	CLIP-seq
MIRT1495285	hsa-miR-934	CLIP-seq
MIRT1495286	hsa-miR-942	CLIP-seq
MIRT1495169	hsa-miR-1225-3p	CLIP-seq
MIRT1495170	hsa-miR-1251	CLIP-seq
MIRT1495171	hsa-miR-1269	CLIP-seq
MIRT1495172	hsa-miR-1269b	CLIP-seq
MIRT1495173	hsa-miR-1276	CLIP-seq
MIRT1495174	hsa-miR-1287	CLIP-seq
MIRT1495175	hsa-miR-1288	CLIP-seq
MIRT1495176	hsa-miR-1324	CLIP-seq
MIRT1495177	hsa-miR-144	CLIP-seq
MIRT1495178	hsa-miR-145	CLIP-seq
MIRT1495180	hsa-miR-2054	CLIP-seq
MIRT1495181	hsa-miR-214	CLIP-seq
MIRT1495182	hsa-miR-2682	CLIP-seq
MIRT2149195	hsa-miR-2909	CLIP-seq
MIRT1495183	hsa-miR-302f	CLIP-seq
MIRT1495184	hsa-miR-3117-3p	CLIP-seq
MIRT1495186	hsa-miR-3121-3p	CLIP-seq
MIRT1495187	hsa-miR-3125	CLIP-seq
MIRT1495188	hsa-miR-3126-5p	CLIP-seq
MIRT1495189	hsa-miR-3132	CLIP-seq
MIRT1495191	hsa-miR-3135b	CLIP-seq
MIRT1495192	hsa-miR-3148	CLIP-seq
MIRT1495193	hsa-miR-3153	CLIP-seq
MIRT2149196	hsa-miR-3162-5p	CLIP-seq
MIRT1495194	hsa-miR-3168	CLIP-seq
MIRT1495195	hsa-miR-3169	CLIP-seq
MIRT1495196	hsa-miR-3200-3p	CLIP-seq
MIRT1495197	hsa-miR-320b	CLIP-seq
MIRT1495198	hsa-miR-320d	CLIP-seq
MIRT1495201	hsa-miR-34a	CLIP-seq
MIRT1495202	hsa-miR-34c-5p	CLIP-seq
MIRT1495204	hsa-miR-3616-5p	CLIP-seq
MIRT1495205	hsa-miR-3617	CLIP-seq
MIRT1495206	hsa-miR-3618	CLIP-seq
MIRT1495207	hsa-miR-3619-5p	CLIP-seq
MIRT1495208	hsa-miR-3647-5p	CLIP-seq
MIRT2149197	hsa-miR-3658	CLIP-seq
MIRT1495209	hsa-miR-3665	CLIP-seq
MIRT1495210	hsa-miR-3682-5p	CLIP-seq
MIRT1495211	hsa-miR-376c	CLIP-seq
MIRT1495212	hsa-miR-3916	CLIP-seq
MIRT1495213	hsa-miR-3934	CLIP-seq
MIRT1495214	hsa-miR-3942-3p	CLIP-seq
MIRT1495215	hsa-miR-3943	CLIP-seq
MIRT1495217	hsa-miR-4275	CLIP-seq
MIRT1495218	hsa-miR-4291	CLIP-seq
MIRT1495219	hsa-miR-4313	CLIP-seq
MIRT1495220	hsa-miR-4419a	CLIP-seq
MIRT1495221	hsa-miR-4429	CLIP-seq
MIRT1495222	hsa-miR-4434	CLIP-seq
MIRT1495223	hsa-miR-4438	CLIP-seq
MIRT1495225	hsa-miR-449a	CLIP-seq
MIRT1495226	hsa-miR-449b	CLIP-seq
MIRT1495227	hsa-miR-449c	CLIP-seq
MIRT1495228	hsa-miR-4509	CLIP-seq
MIRT1495229	hsa-miR-4510	CLIP-seq
MIRT1495230	hsa-miR-4514	CLIP-seq
MIRT1495231	hsa-miR-4515	CLIP-seq
MIRT1495232	hsa-miR-4516	CLIP-seq
MIRT1495233	hsa-miR-4517	CLIP-seq
MIRT1495234	hsa-miR-4529-3p	CLIP-seq
MIRT1495235	hsa-miR-4531	CLIP-seq
MIRT1495236	hsa-miR-4539	CLIP-seq
MIRT1495237	hsa-miR-4635	CLIP-seq
MIRT1495238	hsa-miR-4645-5p	CLIP-seq
MIRT2149198	hsa-miR-4662a-3p	CLIP-seq
MIRT2149199	hsa-miR-4668-5p	CLIP-seq
MIRT1495239	hsa-miR-4673	CLIP-seq
MIRT1495240	hsa-miR-4684-5p	CLIP-seq
MIRT1495241	hsa-miR-4690-5p	CLIP-seq
MIRT1495242	hsa-miR-4691-5p	CLIP-seq
MIRT1495243	hsa-miR-4692	CLIP-seq
MIRT1495244	hsa-miR-4694-3p	CLIP-seq
MIRT1495245	hsa-miR-4703-3p	CLIP-seq
MIRT1495246	hsa-miR-4704-5p	CLIP-seq
MIRT1495247	hsa-miR-4709-5p	CLIP-seq
MIRT1495248	hsa-miR-4712-3p	CLIP-seq
MIRT1495249	hsa-miR-4712-5p	CLIP-seq
MIRT1495251	hsa-miR-4716-5p	CLIP-seq
MIRT1495252	hsa-miR-4719	CLIP-seq
MIRT2149200	hsa-miR-4725-5p	CLIP-seq
MIRT1495254	hsa-miR-4740-5p	CLIP-seq
MIRT1495255	hsa-miR-4759	CLIP-seq
MIRT1495256	hsa-miR-4764-5p	CLIP-seq
MIRT2149201	hsa-miR-504	CLIP-seq
MIRT1495257	hsa-miR-513a-3p	CLIP-seq
MIRT1495258	hsa-miR-513b	CLIP-seq
MIRT1495259	hsa-miR-513c	CLIP-seq
MIRT1495260	hsa-miR-514b-5p	CLIP-seq
MIRT1495261	hsa-miR-522	CLIP-seq
MIRT1495262	hsa-miR-526b	CLIP-seq
MIRT1495264	hsa-miR-548a-3p	CLIP-seq
MIRT1495266	hsa-miR-548e	CLIP-seq
MIRT1495267	hsa-miR-548f	CLIP-seq
MIRT1495268	hsa-miR-548k	CLIP-seq
MIRT1495269	hsa-miR-548n	CLIP-seq
MIRT1495270	hsa-miR-548t	CLIP-seq
MIRT1495271	hsa-miR-550b	CLIP-seq
MIRT1495272	hsa-miR-573	CLIP-seq
MIRT2149202	hsa-miR-577	CLIP-seq
MIRT1495273	hsa-miR-600	CLIP-seq
MIRT1495274	hsa-miR-619	CLIP-seq
MIRT1495276	hsa-miR-633	CLIP-seq
MIRT1495277	hsa-miR-637	CLIP-seq
MIRT1495278	hsa-miR-641	CLIP-seq
MIRT1495280	hsa-miR-654-3p	CLIP-seq
MIRT1495281	hsa-miR-761	CLIP-seq
MIRT1495282	hsa-miR-770-5p	CLIP-seq
MIRT1495283	hsa-miR-877	CLIP-seq
MIRT1495284	hsa-miR-922	CLIP-seq
MIRT1495285	hsa-miR-934	CLIP-seq
MIRT1495286	hsa-miR-942	CLIP-seq
MIRT1495169	hsa-miR-1225-3p	CLIP-seq
MIRT1495170	hsa-miR-1251	CLIP-seq
MIRT1495171	hsa-miR-1269	CLIP-seq
MIRT1495172	hsa-miR-1269b	CLIP-seq
MIRT1495173	hsa-miR-1276	CLIP-seq
MIRT1495174	hsa-miR-1287	CLIP-seq
MIRT1495175	hsa-miR-1288	CLIP-seq
MIRT1495176	hsa-miR-1324	CLIP-seq
MIRT1495177	hsa-miR-144	CLIP-seq
MIRT1495178	hsa-miR-145	CLIP-seq
MIRT1495180	hsa-miR-2054	CLIP-seq
MIRT1495181	hsa-miR-214	CLIP-seq
MIRT1495182	hsa-miR-2682	CLIP-seq
MIRT1495184	hsa-miR-3117-3p	CLIP-seq
MIRT1495186	hsa-miR-3121-3p	CLIP-seq
MIRT1495188	hsa-miR-3126-5p	CLIP-seq
MIRT1495191	hsa-miR-3135b	CLIP-seq
MIRT1495192	hsa-miR-3148	CLIP-seq
MIRT1495194	hsa-miR-3168	CLIP-seq
MIRT1495195	hsa-miR-3169	CLIP-seq
MIRT1495196	hsa-miR-3200-3p	CLIP-seq
MIRT1495197	hsa-miR-320b	CLIP-seq
MIRT1495198	hsa-miR-320d	CLIP-seq
MIRT1495201	hsa-miR-34a	CLIP-seq
MIRT1495202	hsa-miR-34c-5p	CLIP-seq
MIRT1495203	hsa-miR-3612	CLIP-seq
MIRT1495204	hsa-miR-3616-5p	CLIP-seq
MIRT1495207	hsa-miR-3619-5p	CLIP-seq
MIRT1495208	hsa-miR-3647-5p	CLIP-seq
MIRT1495209	hsa-miR-3665	CLIP-seq
MIRT1495210	hsa-miR-3682-5p	CLIP-seq
MIRT1495211	hsa-miR-376c	CLIP-seq
MIRT1495213	hsa-miR-3934	CLIP-seq
MIRT1495214	hsa-miR-3942-3p	CLIP-seq
MIRT1495215	hsa-miR-3943	CLIP-seq
MIRT1495216	hsa-miR-4271	CLIP-seq
MIRT1495217	hsa-miR-4275	CLIP-seq
MIRT1495218	hsa-miR-4291	CLIP-seq
MIRT1495219	hsa-miR-4313	CLIP-seq
MIRT1495220	hsa-miR-4419a	CLIP-seq
MIRT1495221	hsa-miR-4429	CLIP-seq
MIRT1495222	hsa-miR-4434	CLIP-seq
MIRT1495223	hsa-miR-4438	CLIP-seq
MIRT1495224	hsa-miR-4443	CLIP-seq
MIRT1495225	hsa-miR-449a	CLIP-seq
MIRT1495226	hsa-miR-449b	CLIP-seq
MIRT1495227	hsa-miR-449c	CLIP-seq
MIRT1495228	hsa-miR-4509	CLIP-seq
MIRT1495229	hsa-miR-4510	CLIP-seq
MIRT1495230	hsa-miR-4514	CLIP-seq
MIRT1495231	hsa-miR-4515	CLIP-seq
MIRT1495232	hsa-miR-4516	CLIP-seq
MIRT1495233	hsa-miR-4517	CLIP-seq
MIRT1495234	hsa-miR-4529-3p	CLIP-seq
MIRT1495235	hsa-miR-4531	CLIP-seq
MIRT1495236	hsa-miR-4539	CLIP-seq
MIRT1495237	hsa-miR-4635	CLIP-seq
MIRT1495238	hsa-miR-4645-5p	CLIP-seq
MIRT1495239	hsa-miR-4673	CLIP-seq
MIRT1495240	hsa-miR-4684-5p	CLIP-seq
MIRT1495241	hsa-miR-4690-5p	CLIP-seq
MIRT1495242	hsa-miR-4691-5p	CLIP-seq
MIRT1495243	hsa-miR-4692	CLIP-seq
MIRT1495244	hsa-miR-4694-3p	CLIP-seq
MIRT1495245	hsa-miR-4703-3p	CLIP-seq
MIRT1495246	hsa-miR-4704-5p	CLIP-seq
MIRT1495247	hsa-miR-4709-5p	CLIP-seq
MIRT1495248	hsa-miR-4712-3p	CLIP-seq
MIRT1495249	hsa-miR-4712-5p	CLIP-seq
MIRT1495250	hsa-miR-4716-3p	CLIP-seq
MIRT1495253	hsa-miR-4725-3p	CLIP-seq
MIRT2149200	hsa-miR-4725-5p	CLIP-seq
MIRT1495254	hsa-miR-4740-5p	CLIP-seq
MIRT1495255	hsa-miR-4759	CLIP-seq
MIRT1495256	hsa-miR-4764-5p	CLIP-seq
MIRT2149201	hsa-miR-504	CLIP-seq
MIRT1495257	hsa-miR-513a-3p	CLIP-seq
MIRT1495259	hsa-miR-513c	CLIP-seq
MIRT1495260	hsa-miR-514b-5p	CLIP-seq
MIRT1495261	hsa-miR-522	CLIP-seq
MIRT1495264	hsa-miR-548a-3p	CLIP-seq
MIRT1495266	hsa-miR-548e	CLIP-seq
MIRT1495267	hsa-miR-548f	CLIP-seq
MIRT1495268	hsa-miR-548k	CLIP-seq
MIRT1495271	hsa-miR-550b	CLIP-seq
MIRT1495272	hsa-miR-573	CLIP-seq
MIRT1495273	hsa-miR-600	CLIP-seq
MIRT1495274	hsa-miR-619	CLIP-seq
MIRT1495275	hsa-miR-625	CLIP-seq
MIRT1495276	hsa-miR-633	CLIP-seq
MIRT1495277	hsa-miR-637	CLIP-seq
MIRT1495279	hsa-miR-650	CLIP-seq
MIRT1495280	hsa-miR-654-3p	CLIP-seq
MIRT1495281	hsa-miR-761	CLIP-seq
MIRT1495282	hsa-miR-770-5p	CLIP-seq
MIRT1495284	hsa-miR-922	CLIP-seq
MIRT1495286	hsa-miR-942	CLIP-seq
MIRT1495176	hsa-miR-1324	CLIP-seq
MIRT1495223	hsa-miR-4438	CLIP-seq
MIRT1495286	hsa-miR-942	CLIP-seq
MIRT1495178	hsa-miR-145	CLIP-seq
MIRT1495180	hsa-miR-2054	CLIP-seq
MIRT1495182	hsa-miR-2682	CLIP-seq
MIRT1495194	hsa-miR-3168	CLIP-seq
MIRT1495197	hsa-miR-320b	CLIP-seq
MIRT1495198	hsa-miR-320d	CLIP-seq
MIRT1495201	hsa-miR-34a	CLIP-seq
MIRT1495202	hsa-miR-34c-5p	CLIP-seq
MIRT2149197	hsa-miR-3658	CLIP-seq
MIRT1495210	hsa-miR-3682-5p	CLIP-seq
MIRT1495217	hsa-miR-4275	CLIP-seq
MIRT1495221	hsa-miR-4429	CLIP-seq
MIRT1495223	hsa-miR-4438	CLIP-seq
MIRT1495225	hsa-miR-449a	CLIP-seq
MIRT1495226	hsa-miR-449b	CLIP-seq
MIRT1495227	hsa-miR-449c	CLIP-seq
MIRT1495230	hsa-miR-4514	CLIP-seq
MIRT1495233	hsa-miR-4517	CLIP-seq
MIRT1495238	hsa-miR-4645-5p	CLIP-seq
MIRT2149198	hsa-miR-4662a-3p	CLIP-seq
MIRT1495239	hsa-miR-4673	CLIP-seq
MIRT1495242	hsa-miR-4691-5p	CLIP-seq
MIRT1495243	hsa-miR-4692	CLIP-seq
MIRT1495245	hsa-miR-4703-3p	CLIP-seq
MIRT1495249	hsa-miR-4712-5p	CLIP-seq
MIRT1495259	hsa-miR-513c	CLIP-seq
MIRT1495260	hsa-miR-514b-5p	CLIP-seq
MIRT1495268	hsa-miR-548k	CLIP-seq
MIRT1495269	hsa-miR-548n	CLIP-seq
MIRT1495270	hsa-miR-548t	CLIP-seq
MIRT1495271	hsa-miR-550b	CLIP-seq
MIRT2149202	hsa-miR-577	CLIP-seq
MIRT1495276	hsa-miR-633	CLIP-seq
MIRT1495282	hsa-miR-770-5p	CLIP-seq
MIRT1495286	hsa-miR-942	CLIP-seq
MIRT1495182	hsa-miR-2682	CLIP-seq
MIRT1495194	hsa-miR-3168	CLIP-seq
MIRT1495197	hsa-miR-320b	CLIP-seq
MIRT1495198	hsa-miR-320d	CLIP-seq
MIRT1495201	hsa-miR-34a	CLIP-seq
MIRT1495202	hsa-miR-34c-5p	CLIP-seq
MIRT2149197	hsa-miR-3658	CLIP-seq
MIRT1495217	hsa-miR-4275	CLIP-seq
MIRT1495221	hsa-miR-4429	CLIP-seq
MIRT1495223	hsa-miR-4438	CLIP-seq
MIRT1495225	hsa-miR-449a	CLIP-seq
MIRT1495226	hsa-miR-449b	CLIP-seq
MIRT1495227	hsa-miR-449c	CLIP-seq
MIRT1495230	hsa-miR-4514	CLIP-seq
MIRT1495236	hsa-miR-4539	CLIP-seq
MIRT1495238	hsa-miR-4645-5p	CLIP-seq
MIRT2149198	hsa-miR-4662a-3p	CLIP-seq
MIRT1495239	hsa-miR-4673	CLIP-seq
MIRT1495242	hsa-miR-4691-5p	CLIP-seq
MIRT1495243	hsa-miR-4692	CLIP-seq
MIRT1495245	hsa-miR-4703-3p	CLIP-seq
MIRT1495248	hsa-miR-4712-3p	CLIP-seq
MIRT1495259	hsa-miR-513c	CLIP-seq
MIRT1495260	hsa-miR-514b-5p	CLIP-seq
MIRT1495268	hsa-miR-548k	CLIP-seq
MIRT1495269	hsa-miR-548n	CLIP-seq
MIRT1495270	hsa-miR-548t	CLIP-seq
MIRT2149202	hsa-miR-577	CLIP-seq
MIRT1495286	hsa-miR-942	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
ATF6	Unknown	20003459;24269637
BACH2	Repression	24821775
BCL6	Repression	24821775
CEBPB	Activation	19717648
PAX5	Repression	8627152

160

Show/Hide all (160)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	16461360, 25239945, 25280941
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	23184933, 25190803
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	11779464
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS	20408817
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	2196176
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	ISS
GO:0001558	Process	Regulation of cell growth	IDA	23529610
GO:0001889	Process	Liver development	IEA
GO:0001889	Process	Liver development	ISS
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	25190803
GO:0001935	Process	Endothelial cell proliferation	IDA	23529610
GO:0001935	Process	Endothelial cell proliferation	IEA
GO:0002020	Function	Protease binding	IPI	25239945
GO:0002071	Process	Glandular epithelial cell maturation	IEA
GO:0002639	Process	Positive regulation of immunoglobulin production	IDA	11460154
GO:0002639	Process	Positive regulation of immunoglobulin production	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	1718857
GO:0003700	Function	DNA-binding transcription factor activity	IDA	1903538, 8657566, 31387940
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	1718857, 2321018
GO:0005515	Function	Protein binding	IPI	16461360, 20102225, 23661758, 24670641, 25190803, 25239945, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16461360
GO:0005634	Component	Nucleus	IDA	16461360, 20348923, 20955178
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	23661758
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	16461360, 25190803
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA	23529610
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	25239945
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IDA	20348923
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	23661758
GO:0006366	Process	Transcription by RNA polymerase II	ISS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	ISS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	TAS	22013210
GO:0006914	Process	Autophagy	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006955	Process	Immune response	TAS	1718857, 22013210
GO:0006986	Process	Response to unfolded protein	IEA
GO:0007517	Process	Muscle organ development	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	25656649
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	25656649
GO:0010506	Process	Regulation of autophagy	IEA
GO:0010508	Process	Positive regulation of autophagy	IDA	23184933
GO:0010832	Process	Negative regulation of myotube differentiation	ISS
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	20348923
GO:0030154	Process	Cell differentiation	IEA
GO:0030331	Function	Nuclear estrogen receptor binding	TAS	22013210
GO:0030335	Process	Positive regulation of cell migration	IDA	25656649
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IDA	26315405
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IDA	25239945, 31387940
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	ISS
GO:0031017	Process	Exocrine pancreas development	IEA
GO:0031490	Function	Chromatin DNA binding	IDA	25280941
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	25239945
GO:0031647	Process	Regulation of protein stability	IDA	25190803
GO:0031648	Process	Protein destabilization	IDA	16461360, 25239945
GO:0031648	Process	Protein destabilization	IEA
GO:0031648	Process	Protein destabilization	IMP	25280941
GO:0031670	Process	Cellular response to nutrient	ISS
GO:0032008	Process	Positive regulation of TOR signaling	IMP	25190803
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032869	Process	Cellular response to insulin stimulus	ISS
GO:0034599	Process	Cellular response to oxidative stress	IDA	25190803
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	11779464, 16461360, 20348923, 25239945
GO:0034976	Process	Response to endoplasmic reticulum stress	TAS	22013210
GO:0035356	Process	Intracellular triglyceride homeostasis	IEA
GO:0035356	Process	Intracellular triglyceride homeostasis	ISS
GO:0035470	Process	Positive regulation of vascular wound healing	IDA	25656649
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IDA	23529610
GO:0036498	Process	IRE1-mediated unfolded protein response	TAS	22013210, 22934019
GO:0036500	Process	ATF6-mediated unfolded protein response	NAS	32046286
GO:0036503	Process	ERAD pathway	NAS	17765680
GO:0042149	Process	Cellular response to glucose starvation	IEA
GO:0042149	Process	Cellular response to glucose starvation	ISS
GO:0042307	Process	Positive regulation of protein import into nucleus	IDA	25190803
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0042802	Function	Identical protein binding	IPI	20102225, 23661758
GO:0042826	Function	Histone deacetylase binding	ISS	20408817
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	31387940
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	23529610
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044389	Function	Ubiquitin-like protein ligase binding	ISS	20408817
GO:0045348	Process	Positive regulation of MHC class II biosynthetic process	IMP	1903538
GO:0045579	Process	Positive regulation of B cell differentiation	IDA	11460154
GO:0045582	Process	Positive regulation of T cell differentiation	IDA	11460154
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	ISS
GO:0045766	Process	Positive regulation of angiogenesis	IMP	25656649
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	8657566, 11779464, 16461360, 23184933, 25190803, 25239945
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	1903538
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS	22013210
GO:0046982	Function	Protein heterodimerization activity	IDA	1903538
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IDA	23529610
GO:0048666	Process	Neuron development	ISS
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	26315405
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	26315405
GO:0055089	Process	Fatty acid homeostasis	IEA
GO:0055089	Process	Fatty acid homeostasis	ISS
GO:0055092	Process	Sterol homeostasis	IEA
GO:0055092	Process	Sterol homeostasis	ISS
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IDA	26315405
GO:0060612	Process	Adipose tissue development	IEA
GO:0060612	Process	Adipose tissue development	ISS
GO:0060691	Process	Epithelial cell maturation involved in salivary gland development	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	26315405
GO:0071073	Process	Positive regulation of phospholipid biosynthetic process	TAS	22013210
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	11460154
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	ISS
GO:0071332	Process	Cellular response to fructose stimulus	ISS
GO:0071333	Process	Cellular response to glucose stimulus	ISS
GO:0071353	Process	Cellular response to interleukin-4	IEA
GO:0071353	Process	Cellular response to interleukin-4	ISS
GO:0071375	Process	Cellular response to peptide hormone stimulus	IEA
GO:0071375	Process	Cellular response to peptide hormone stimulus	ISS
GO:0071498	Process	Cellular response to fluid shear stress	IDA	25190803, 25280941
GO:0071499	Process	Cellular response to laminar fluid shear stress	IDA	25280941
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	23661758
GO:1900100	Process	Positive regulation of plasma cell differentiation	IDA	11460154
GO:1900102	Process	Negative regulation of endoplasmic reticulum unfolded protein response	IDA	25239945
GO:1901985	Process	Positive regulation of protein acetylation	IDA	25280941
GO:1902236	Process	Negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IDA	19135031
GO:1903489	Process	Positive regulation of lactation	IEA
GO:1903489	Process	Positive regulation of lactation	ISS
GO:1904294	Process	Positive regulation of ERAD pathway	TAS	22013210
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IDA	26315405
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IDA	26315405
GO:1904754	Process	Positive regulation of vascular associated smooth muscle cell migration	IDA	26315405
GO:1904754	Process	Positive regulation of vascular associated smooth muscle cell migration	IDA	26315405
GO:1990418	Process	Response to insulin-like growth factor stimulus	IEA
GO:1990418	Process	Response to insulin-like growth factor stimulus	ISS
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000347	Process	Positive regulation of hepatocyte proliferation	IEA
GO:2000347	Process	Positive regulation of hepatocyte proliferation	ISS
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IDA	25280941

MIM	HGNC	e!Ensembl
194355	12801	ENSG00000100219

P17861

Protein name

X-box-binding protein 1 (XBP-1) (Tax-responsive element-binding protein 5) (TREB-5) [Cleaved into: X-box-binding protein 1, cytoplasmic form; X-box-binding protein 1, luminal form]

Protein function

Functions as a transcription factor during endoplasmic reticulum (ER) stress by regulating the unfolded protein response (UPR). Required for cardiac myogenesis and hepatogenesis during embryonic development, and the development of secretory tiss

PDB

6R5Q , 6R6G , 6R6P , 6R7Q

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07716	bZIP_2	68 → 122	Basic region leucine zipper	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Expressed in plasma cells in rheumatoid synovium (PubMed:11460154). Over-expressed in primary breast cancer and metastatic breast cancer cells (PubMed:25280941). Isoform 1 and isoform 2 are expressed at higher level in proliferating as

Sequence

MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARK
RQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLR
EKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQL
SPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVP
YQPPFLCQWGRHQPSWKPLMN

Sequence length

261

Interactions

View interactions

	KEGG		Reactome
	Protein processing in endoplasmic reticulum Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Spinocerebellar ataxia Pathways of neurodegeneration - multiple diseases Lipid and atherosclerosis		XBP1(S) activates chaperone genes IRE1alpha activates chaperones ATF6 (ATF6-alpha) activates chaperone genes

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal dominant polycystic liver disease	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major affective disorder 7	Uncertain significance	ClinVar CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MULTIPLE SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (258)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	19659458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	28837265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	11813207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19861963, 30121368, 31138662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28337298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	17352224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	27631436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	19751410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	19380033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	22078940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	23421912, 29725981, 40430038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29427089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	19762508, 19797764, 22390177, 24681403, 29725981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	29725981	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	19762508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	29089350		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27941872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	29089350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	31239294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29089350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19669932, 19751410, 28620068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	29720240	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	29720240	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24387801	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29720240	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29064281, 30355343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	29064281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19669932, 19751410, 28620068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	27373828		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19176362, 19380033, 19389935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	12949534, 15184063, 15331160, 15892135, 15927087, 15948763, 16154272, 16539657, 18771604, 19154631, 19564049, 25231123, 29843019		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	12949534		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	12949534, 15298659, 15380296, 15927087, 16154272, 16539657, 18771604, 19154631	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	18771604, 25231123		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	17217928		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	PSYGENET_DG	17217928		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27472396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	22427205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	15927087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14634507, 15149721, 17352224, 17660348, 18386815, 20208137, 21858728, 24670641, 25280941, 25368386, 26517687, 27109102, 28707320, 29276395, 29339455 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12954762, 12960427, 17352224, 19861963, 20208137, 22681620, 27109102, 28187708, 29339455, 31554371, 32883354, 33291081, 34418985, 35543228, 36997866, 38203358 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	BEFREE	31082732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	15927087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	36012375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17352224, 26633383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16364319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27472396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	24194940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30250617, 30305738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36012132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	26091066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	25001514, 30317635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28487326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	36520816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24812669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	23421912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	29276149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	18775308, 28333149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	32908909, 35185383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17352224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36246978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17352224, 25692573, 29169174, 30473215, 31227689, 31243264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17352224	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31227689	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31243264, 32323831, 32888357	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	30503671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	26055788, 26572862, 27133203, 31177839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	18775308, 21252204, 23300802, 24247223, 30818349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	18775308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	23300802, 30818349, 31694333	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	30250617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	19321437, 26331676, 28075361, 31428093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	26331676, 31428093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24269637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	19154631, 29574669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	19154631	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	24703171	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	31031005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24985580, 28079229, 28630460, 30612139, 31156553, 31242599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24985580, 28079229, 28630460, 30612139, 31156553, 31242599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	31242599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17906960, 21892182, 26299655, 28630460, 29061071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	25754093, 31077568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30612139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	19176362, 19380033, 19389935, 28167662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	19751410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	36997866	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	38203358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37880674, 39986022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30250617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	28928666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	24194940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
EPIPHYSEAL DYSPLASIA, MULTIPLE, 5	Epiphyseal dysplasia	BEFREE	31260448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	30745418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	GWASDB_DG	22960999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	GWASCAT_DG	22960999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	29581854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	CTD_human_DG	24097666		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	BEFREE	25170079, 31123148, 31541078		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Disease	Fatty Liver	BEFREE	24097666, 26472223, 30466110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27996033		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	29563863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	29725981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	30541862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29311133, 31534165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21138464, 26680227, 31700088		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	CTD_human_DG	21138464		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	40621799	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	30574153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss, High-Frequency	Hearing Loss	BEFREE	25973683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	26055788, 26572862, 27133203, 31177839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	26055788	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	19176362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	17352224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21062387, 38479365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	22078940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	22337954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	19669932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	26469762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	35421066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	19751410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotriglyceridemia	Hypotriglyceridemia	BEFREE	19751410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26633383	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	40621799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	23400395, 30899368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	18635891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29074489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	34209019	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	22215754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	37054944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	BEFREE	19735688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	25978849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	18775305, 18775308, 19237300, 19865077, 22028783, 28333149, 31563276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	31031005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	31563276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	19669932, 28487326, 30317635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	19403667, 20980528, 31801863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31601454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19659458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19470730, 19659458, 21266233, 26934650, 27840425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	29305191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12713871, 26186544, 26540043, 28835517, 29627568, 30214606, 30405792, 30415242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	36520816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	26186544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	17586700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	15006602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	15006602, 32576923, 35059734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36165173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	16418334, 19176362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	24812669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	30348636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	31801863		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	CTD_human_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Major depression, single episode	Mental Depression	BEFREE	19154631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	19154631, 24703171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	21138464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14634507, 15149721, 17352224, 17660348, 18386815, 19861963, 20208137, 21858728, 24670641, 25280941, 25368386, 26517687, 27109102, 28111258, 28707320 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29305191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12960427, 30250617, 30305738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30679434, 31804970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23108377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27472396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16861911, 17352224, 19176362, 21993678, 24362465, 25692573, 25794824, 26633383, 27307600, 28079229, 29089645, 29358668, 29916547, 30305738, 30783083, 31041814, 31086333, 31205564 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17352224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12067985, 14576841, 17660348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17660348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21423203, 26018731, 28222747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28222747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29574669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	25231123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	26803729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	21633399	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	19751410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metaphyseal chondrodysplasia	Metaphyseal Chondrodysplasia	BEFREE	31260448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metaphyseal chondrodysplasia Schmid type	Metaphyseal chondrodysplasia	Pubtator	28440393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	21138464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Epiphyseal Dysplasia	Multiple Epiphyseal Dysplasia	BEFREE	31260448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10375612, 12846805, 16002735, 16396777, 17257674, 17418411, 18192112, 19389935, 20421453, 21993678, 22427205, 22538852, 24077352, 24356728, 24362465 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12200383, 12969976, 14695887, 19755988, 20421453, 21723843, 21993678, 25743686, 27634301, 28052011, 29089645, 35276027, 37054944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	17418411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18344911		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	29483082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	35405004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	26572862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	26091066	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	26351848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	25978849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	17494074, 28216622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	19435892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	24194940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15342372, 16396777, 16861911, 18386815, 19176362, 21325069, 23599149, 24670641, 25901709, 25972487, 26680227, 29169174, 29311133, 29456105, 29581854 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25336154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29650257		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	16154272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	19751410, 26472223, 27996033, 28278289, 28480888, 30466110, 31541078		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	24097666		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23510626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	24097666		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	26472223		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	18840627, 21892182, 27356931, 29551634, 29891850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18840627, 27481183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	17660348, 27109102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	31187548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	30414263, 31187548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	21294793, 37907740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	30317635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	26091066	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26633383, 30936750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	26633383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	30250617		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30250617, 30305738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	12960427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33517887, 37651191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	25077966, 27941872, 31506423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	19135031, 24753614, 28717189, 31135066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	27302879, 29921943, 36894919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	31836774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35288480	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	24821775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	30178863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30679434, 31804970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31986411, 37857190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31031005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	23400395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30899368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	32641679	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	24387801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	31801863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15184063, 15298659, 15936534, 16342282, 16958950, 18335162		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	15184063		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15184063, 16342282, 16958950		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	15298659, 37376599	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Diffuse	Scleroderma	Pubtator	23400395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Selective immunoglobulin A deficiency	Selective Immunoglobulin A Deficiency	BEFREE	19735688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31601454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	25972487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	GWASCAT_DG	22960999		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	BEFREE	26796273, 29305191, 29916547, 30032821		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	GWASCAT_DG	25129146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29916547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	30414263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	24097666, 25170079, 26472223, 27689765, 31123148, 31541078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	24097666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23108377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33982777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subclinical hypothyroidism	Subclinical Hypothyroidism	BEFREE	31156553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	36639835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24670641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29440447, 36157217, 39206896, 39986022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	18775308, 21252204, 26900298, 28757346, 28928666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	18775308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	19154631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	19543371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	19543371, 35046957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	19543371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	19220283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	19220283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

XBP1 (X-box binding protein 1)