WNT9B (Wnt family member 9B)

Gene

• Entrez ID: 7484
• Gene name: Wnt family member 9B
• Gene symbol: WNT9B
• Synonyms (NCBI Gene): WNT14B, WNT15
• Chromosome: 17
• Chromosome location: 17q21.32
• Summary: The WNT gene family consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryoge

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004682	hsa-miR-324-3p	Luciferase reporter assay	19478946
MIRT651506	hsa-miR-5193	HITS-CLIP	23824327
MIRT651507	hsa-miR-513a-5p	HITS-CLIP	23824327
MIRT651505	hsa-miR-27a-3p	HITS-CLIP	23824327
MIRT651504	hsa-miR-27b-3p	HITS-CLIP	23824327
MIRT651503	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT442335	hsa-miR-3614-5p	PAR-CLIP	22100165
MIRT442334	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT442333	hsa-miR-4271	PAR-CLIP	22100165
MIRT442332	hsa-miR-4725-3p	PAR-CLIP	22100165
MIRT442330	hsa-miR-6780b-5p	PAR-CLIP	22100165
MIRT442331	hsa-miR-625-5p	PAR-CLIP	22100165
MIRT442329	hsa-miR-4723-5p	PAR-CLIP	22100165
MIRT442328	hsa-miR-5698	PAR-CLIP	22100165
MIRT442327	hsa-miR-6870-5p	PAR-CLIP	22100165
MIRT442326	hsa-miR-7111-5p	PAR-CLIP	22100165
MIRT442325	hsa-miR-4525	PAR-CLIP	22100165
MIRT442323	hsa-miR-5010-5p	PAR-CLIP	22100165
MIRT442324	hsa-miR-4436b-5p	PAR-CLIP	22100165
MIRT442322	hsa-miR-1275	PAR-CLIP	22100165
MIRT442321	hsa-miR-4665-5p	PAR-CLIP	22100165
MIRT442320	hsa-miR-7109-5p	PAR-CLIP	22100165
MIRT442319	hsa-miR-6751-5p	PAR-CLIP	22100165
MIRT442318	hsa-miR-6803-5p	PAR-CLIP	22100165
MIRT736836	hsa-miR-20b-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31867895
MIRT651506	hsa-miR-5193	HITS-CLIP	23824327
MIRT651507	hsa-miR-513a-5p	HITS-CLIP	23824327
MIRT651505	hsa-miR-27a-3p	HITS-CLIP	23824327
MIRT651504	hsa-miR-27b-3p	HITS-CLIP	23824327
MIRT651503	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT442335	hsa-miR-3614-5p	PAR-CLIP	22100165
MIRT442334	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT442333	hsa-miR-4271	PAR-CLIP	22100165
MIRT442332	hsa-miR-4725-3p	PAR-CLIP	22100165
MIRT442330	hsa-miR-6780b-5p	PAR-CLIP	22100165
MIRT442331	hsa-miR-625-5p	PAR-CLIP	22100165
MIRT442329	hsa-miR-4723-5p	PAR-CLIP	22100165
MIRT442328	hsa-miR-5698	PAR-CLIP	22100165
MIRT442327	hsa-miR-6870-5p	PAR-CLIP	22100165
MIRT442326	hsa-miR-7111-5p	PAR-CLIP	22100165
MIRT442325	hsa-miR-4525	PAR-CLIP	22100165
MIRT442323	hsa-miR-5010-5p	PAR-CLIP	22100165
MIRT442324	hsa-miR-4436b-5p	PAR-CLIP	22100165
MIRT442322	hsa-miR-1275	PAR-CLIP	22100165
MIRT442321	hsa-miR-4665-5p	PAR-CLIP	22100165
MIRT442320	hsa-miR-7109-5p	PAR-CLIP	22100165
MIRT442319	hsa-miR-6751-5p	PAR-CLIP	22100165
MIRT442318	hsa-miR-6803-5p	PAR-CLIP	22100165
MIRT2148880	hsa-miR-4639-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001822	Process	Kidney development	IEA
GO:0003339	Process	Regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005109	Function	Frizzled binding	IBA
GO:0005125	Function	Cytokine activity	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0009786	Process	Regulation of asymmetric cell division	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	ISS
GO:0030539	Process	Male genitalia development	IEA
GO:0032526	Process	Response to retinoic acid	NAS	11604992
GO:0035150	Process	Regulation of tube size	IEA
GO:0035567	Process	Non-canonical Wnt signaling pathway	IDA	25640183
GO:0039706	Function	Co-receptor binding	IEA
GO:0045165	Process	Cell fate commitment	IBA
GO:0048018	Function	Receptor ligand activity	IDA	28733458
GO:0048701	Process	Embryonic cranial skeleton morphogenesis	IEA
GO:0048754	Process	Branching morphogenesis of an epithelial tube	IEA
GO:0060021	Process	Roof of mouth development	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	28733458
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	IEA
GO:0060993	Process	Kidney morphogenesis	IEA
GO:0061038	Process	Uterus morphogenesis	IEA
GO:0061303	Process	Cornea development in camera-type eye	ISS	16258938
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:0072003	Process	Kidney rudiment formation	IEA
GO:0072038	Process	Mesenchymal stem cell maintenance involved in nephron morphogenesis	IEA
GO:0072044	Process	Collecting duct development	IEA
GO:0072046	Process	Establishment of planar polarity involved in nephron morphogenesis	IEA
GO:0072078	Process	Nephron tubule morphogenesis	IEA
GO:0072164	Process	Mesonephric tubule development	IEA
GO:0072170	Process	Metanephric tubule development	IEA
GO:0072174	Process	Metanephric tubule formation	IEA
GO:0072181	Process	Mesonephric duct formation	IEA
GO:1902455	Process	Negative regulation of stem cell population maintenance	IMP	25640183
GO:1904948	Process	Midbrain dopaminergic neuron differentiation	IMP	25640183

Other IDs

• MIM: 602864
• HGNC: 12779
• e!Ensembl: ENSG00000158955

Protein

• UniProt ID: O14905
• Protein name: Protein Wnt-9b (Protein Wnt-14b) (Protein Wnt-15)
• Protein function: Ligand for members of the frizzled family of seven transmembrane receptors (Probable). Functions in the canonical Wnt/beta-catenin signaling pathway. Required for normal embryonic kidney development, and for normal development of the urogenital
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00110	wnt	56 → 356	wnt family	Family

• Tissue specificity: TISSUE SPECIFICITY: Moderately expressed in fetal kidney and adult kidney. Also found in brain.
• Sequence:

  MRPPPALALAGLCLLALPAAAASYFGLTGREVLTPFPGLGTAAAPAQGGAHLKQCDLLKL
  SRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRHERWNCSLEGRMGLLKRGFKETAFLY
  AVSSAALTHTLARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSK
  RGNKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKL
  RYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGDLVYMEDSPSFCRPSKYSPGT
  AGRVCSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCVQEELVYTCKH

• Sequence length: 357

Pathways

KEGG:

mTOR signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Cushing syndrome
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Human papillomavirus infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Reactome:

WNT ligand biogenesis and trafficking

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Chronic kidney disease	Likely pathogenic	rs753748759, rs1291189006	RCV001849868 RCV001849869	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cystic renal dysplasia	Likely pathogenic	rs753748759	RCV001849868	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Renal dysplasia	Likely pathogenic	rs1291189006	RCV001849869	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Renal hypoplasia	Likely pathogenic	rs1291189006	RCV001849869	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANTI-NEUTROPHIL ANTIBODY ASSOCIATED VASCULITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ABSENCE OF KIDNEYS SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HYPOPLASIA OF KIDNEY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC DYSPLASIA OF KIDNEY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART SEPTAL DEFECT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WNT9B-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Basal Cell Nevus Syndrome	Basal cell nevus syndrome	Pubtator	28915250	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Exstrophy	Bladder Exstrophy	BEFREE	24852367		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	24437584, 35191549	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	16998816, 24437584		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	24437584, 30870065, 31063268, 31122291, 35191549	Associate	★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	12011973		★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	35697867	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33704824	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Orofacial Cleft 1	Orofacial cleft	Pubtator	18413325, 20890934, 24437584, 28232668, 35191549	Associate	★☆☆☆☆ Found in Text Mining only
Otofaciocervical Syndrome	Otofaciocervical syndrome	Pubtator	35191549	Associate	★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	31831777		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical periodontitis	Pubtator	31831777	Associate	★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	16998816		★☆☆☆☆ Found in Text Mining only