WNT11 (Wnt family member 11)

Gene

• Entrez ID: 7481
• Gene name: Wnt family member 11
• Gene symbol: WNT11
• Synonyms (NCBI Gene): HWNT11
• Chromosome: 11
• Chromosome location: 11q13.5
• Summary: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT707431	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT707430	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT707429	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707428	hsa-miR-6083	HITS-CLIP	21572407
MIRT736461	hsa-miR-504-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	33142356
MIRT707431	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT707430	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT707429	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707428	hsa-miR-6083	HITS-CLIP	21572407
MIRT1493556	hsa-miR-1291	CLIP-seq
MIRT1493557	hsa-miR-1915	CLIP-seq
MIRT1493558	hsa-miR-214	CLIP-seq
MIRT1493559	hsa-miR-24	CLIP-seq
MIRT1493560	hsa-miR-3155	CLIP-seq
MIRT1493561	hsa-miR-3155b	CLIP-seq
MIRT1493562	hsa-miR-328	CLIP-seq
MIRT1493563	hsa-miR-3619-5p	CLIP-seq
MIRT1493564	hsa-miR-3974	CLIP-seq
MIRT1493565	hsa-miR-4265	CLIP-seq
MIRT1493566	hsa-miR-4296	CLIP-seq
MIRT1493567	hsa-miR-4322	CLIP-seq
MIRT1493568	hsa-miR-4417	CLIP-seq
MIRT1493569	hsa-miR-4530	CLIP-seq
MIRT1493570	hsa-miR-4690-5p	CLIP-seq
MIRT1493571	hsa-miR-4742-3p	CLIP-seq
MIRT1493572	hsa-miR-4766-5p	CLIP-seq
MIRT1493573	hsa-miR-484	CLIP-seq
MIRT1493574	hsa-miR-488	CLIP-seq
MIRT1493575	hsa-miR-508-5p	CLIP-seq
MIRT1493576	hsa-miR-520a-5p	CLIP-seq
MIRT1493577	hsa-miR-525-5p	CLIP-seq
MIRT1493578	hsa-miR-761	CLIP-seq
MIRT1493558	hsa-miR-214	CLIP-seq
MIRT1493559	hsa-miR-24	CLIP-seq
MIRT1493560	hsa-miR-3155	CLIP-seq
MIRT1493561	hsa-miR-3155b	CLIP-seq
MIRT1493563	hsa-miR-3619-5p	CLIP-seq
MIRT1493569	hsa-miR-4530	CLIP-seq
MIRT1493570	hsa-miR-4690-5p	CLIP-seq
MIRT1493573	hsa-miR-484	CLIP-seq
MIRT1493578	hsa-miR-761	CLIP-seq
MIRT2397020	hsa-miR-1254	CLIP-seq
MIRT2397021	hsa-miR-3116	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ERG	Activation	21242973

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001822	Process	Kidney development	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IEA
GO:0003138	Process	Primary heart field specification	IEA
GO:0003139	Process	Secondary heart field specification	IEA
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003281	Process	Ventricular septum development	IEA
GO:0003283	Process	Atrial septum development	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005109	Function	Frizzled binding	IBA
GO:0005109	Function	Frizzled binding	NAS	24431302
GO:0005125	Function	Cytokine activity	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 30886144, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IDA	20103596, 20219091
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IMP	20219091
GO:0007223	Process	Wnt signaling pathway, calcium modulating pathway	NAS	24431302
GO:0010463	Process	Mesenchymal cell proliferation	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	ISS
GO:0030282	Process	Bone mineralization	IEA
GO:0030295	Function	Protein kinase activator activity	IMP	20219091
GO:0030325	Process	Adrenal gland development	IEP	9757009
GO:0031012	Component	Extracellular matrix	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0032915	Process	Positive regulation of transforming growth factor beta2 production	IEA
GO:0035556	Process	Intracellular signal transduction	IMP	20103596
GO:0035567	Process	Non-canonical Wnt signaling pathway	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0045165	Process	Cell fate commitment	IBA
GO:0045199	Process	Maintenance of epithelial cell apical/basal polarity	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	19847889
GO:0048341	Process	Paraxial mesoderm formation	IEA
GO:0048570	Process	Notochord morphogenesis	IEA
GO:0048706	Process	Embryonic skeletal system development	IEP	9757009
GO:0048844	Process	Artery morphogenesis	IEA
GO:0060021	Process	Roof of mouth development	IEA
GO:0060028	Process	Convergent extension involved in axis elongation	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	NAS	24431302
GO:0060197	Process	Cloacal septation	IEP	9757009
GO:0060412	Process	Ventricular septum morphogenesis	IEA
GO:0060484	Process	Lung-associated mesenchyme development	IEP	9757009
GO:0060675	Process	Ureteric bud morphogenesis	IEP	9757009
GO:0061037	Process	Negative regulation of cartilage development	NAS	9757009
GO:0061053	Process	Somite development	IEA
GO:0061101	Process	Neuroendocrine cell differentiation	IMP	20219091
GO:0062009	Process	Secondary palate development	IMP	18413325
GO:0070830	Process	Bicellular tight junction assembly	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	IEA
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:0072089	Process	Stem cell proliferation	IEA
GO:0072177	Process	Mesonephric duct development	IEP	9757009
GO:0072201	Process	Negative regulation of mesenchymal cell proliferation	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	20103596
GO:0090272	Process	Negative regulation of fibroblast growth factor production	IEA
GO:1904019	Process	Epithelial cell apoptotic process	IEA
GO:1904037	Process	Positive regulation of epithelial cell apoptotic process	IEA
GO:2000647	Process	Negative regulation of stem cell proliferation	IEA

Other IDs

• MIM: 603699
• HGNC: 12776
• e!Ensembl: ENSG00000085741

Protein

• UniProt ID: O96014
• Protein name: Protein Wnt-11
• Protein function: Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameter
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00110	wnt	47 → 354	wnt family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in fetal lung, kidney, adult heart, liver, skeletal muscle, and pancreas. {ECO:0000269|PubMed:11712081}.
• Sequence:

  MRARPQVCEALLFALALQTGVCYGIKWLALSKTPSALALNQTQHCKQLEGLVSAQVQLCR
  SNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
  AISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
  TGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELQDVAADLKTR
  YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
  KTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK

• Sequence length: 354

Pathways

KEGG:

mTOR signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Cushing syndrome
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Human papillomavirus infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Reactome:

WNT ligand biogenesis and trafficking
Ca2+ pathway
PCP/CE pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BLADDER EXSTROPHY AND EPISPADIAS COMPLEX	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder exstrophy-epispadias-cloacal extrophy complex	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE FRAGILITY WITH CONTRACTURES, ARTERIAL RUPTURE, AND DEAFNESS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypospadias	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
OSTEOARTHRITIS, HAND	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS-PSEUDOGLIOMA SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WNT11-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	LHGDN	11712081		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	31231131		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	11836553		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31718047		★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	27932350		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	31042421		★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	34875064	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17510434, 30579133		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32635983, 34493366, 34911552	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20103596, 27034261	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	31718047		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20103596	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31718047	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23505429	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24606488		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	35208504	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	11712081, 27034261		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11712081, 27034261		★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	29955137		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22161723		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22161723, 30537177, 31261741		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24504536, 37587207	Associate	★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	CTD_human_DG	25783350		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	28878122		★☆☆☆☆ Found in Text Mining only
Congenital hernia of foramen of Bochdalek	Posterolateral diaphragmatic hernia	CTD_human_DG	25783350		★☆☆☆☆ Found in Text Mining only
Congenital hernia of foramen of Morgagni	Morgagni diaphragmatic hernia	CTD_human_DG	25783350		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11712081		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28878122		★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	29955137	Inhibit	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29806631		★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic dysplasia	Pubtator	16942611	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23028188	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26261605	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27329839		★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	36003399	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31834445	Associate	★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	29955137		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	28429362		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21242973		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	30579133		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20103596		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27034261	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17510434, 30579133		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	30579133		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24606488		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15520198, 20219091, 20503398, 29717114		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12072409, 20870744, 21447091, 23806092, 26861754, 29717114, 31261741		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	11712081, 27034261		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22161723		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	21393552	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	26882996		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15520198, 20103596, 20219091, 22161723, 26861754, 27034261, 31261741		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	29806631	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	34875064	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24606488		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24606488	Associate	★☆☆☆☆ Found in Text Mining only
OVERLAP CONNECTIVE TISSUE DISEASE	MASS syndrome	BEFREE	30010216		★☆☆☆☆ Found in Text Mining only
Papillary craniopharyngioma	Papillary Craniopharyngioma	BEFREE	16273260		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	31831777		★☆☆☆☆ Found in Text Mining only
POPLITEAL PTERYGIUM SYNDROME, LETHAL TYPE	Bartsocas-Papas syndrome	BEFREE	31410520		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	21242973		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15520198, 20219091, 20503398, 29717114		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	20219091		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20219091, 29717114	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	31261741		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11712081		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	11712081		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23505429, 30579133		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21393552	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28589081		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	28878122		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17939044		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27034261	Associate	★☆☆☆☆ Found in Text Mining only