WNT7A (Wnt family member 7A)

Gene

• Entrez ID: 7476
• Gene name: Wnt family member 7A
• Gene symbol: WNT7A
• Synonyms (NCBI Gene): SANTOS, Wnt-7a
• Chromosome: 3
• Chromosome location: 3p25.1
• Summary: This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fat

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs75651130	G>A,C	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant, missense variant
rs104893832	C>T	Pathogenic	Missense variant, coding sequence variant
rs104893835	G>A	Pathogenic	Missense variant, coding sequence variant
rs149363953	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs149962459	C>T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs387907231	C>T	Pathogenic-likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs397514643	G>A	Pathogenic	Missense variant, coding sequence variant
rs397514666	C>T	Pathogenic	Missense variant, coding sequence variant
rs879255548	G>A	Pathogenic	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT054418	hsa-miR-195-5p	Luciferase reporter assay, Western blot	24520312
MIRT054420	hsa-miR-497-5p	Luciferase reporter assay, Western blot	24520312
MIRT607119	hsa-miR-8485	HITS-CLIP	23313552
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT607116	hsa-miR-5093	HITS-CLIP	23313552
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT607116	hsa-miR-5093	HITS-CLIP	23313552
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609021	hsa-miR-603	HITS-CLIP	23824327
MIRT609020	hsa-miR-101-3p	HITS-CLIP	23824327
MIRT648849	hsa-miR-144-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT609019	hsa-miR-3941	HITS-CLIP	23824327
MIRT609020	hsa-miR-101-3p	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609021	hsa-miR-603	HITS-CLIP	23824327
MIRT609020	hsa-miR-101-3p	HITS-CLIP	23824327
MIRT648849	hsa-miR-144-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT609019	hsa-miR-3941	HITS-CLIP	23824327
MIRT609020	hsa-miR-101-3p	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609021	hsa-miR-603	HITS-CLIP	23824327
MIRT609020	hsa-miR-101-3p	HITS-CLIP	23824327
MIRT648849	hsa-miR-144-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT609019	hsa-miR-3941	HITS-CLIP	23824327
MIRT609020	hsa-miR-101-3p	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT609021	hsa-miR-603	HITS-CLIP	23824327
MIRT609020	hsa-miR-101-3p	HITS-CLIP	23824327
MIRT648849	hsa-miR-144-3p	HITS-CLIP	23824327
MIRT609019	hsa-miR-3941	HITS-CLIP	23824327
MIRT609020	hsa-miR-101-3p	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	24906430
MIRT607118	hsa-miR-329-3p	HITS-CLIP	24906430
MIRT607117	hsa-miR-362-3p	HITS-CLIP	24906430
MIRT609021	hsa-miR-603	HITS-CLIP	24906430
MIRT609020	hsa-miR-101-3p	HITS-CLIP	24906430
MIRT609019	hsa-miR-3941	HITS-CLIP	24906430
MIRT607119	hsa-miR-8485	HITS-CLIP	24906430
MIRT607118	hsa-miR-329-3p	HITS-CLIP	24906430
MIRT607117	hsa-miR-362-3p	HITS-CLIP	24906430
MIRT607116	hsa-miR-5093	HITS-CLIP	24906430
MIRT607119	hsa-miR-8485	HITS-CLIP	24906430
MIRT607118	hsa-miR-329-3p	HITS-CLIP	24906430
MIRT607117	hsa-miR-362-3p	HITS-CLIP	24906430
MIRT607116	hsa-miR-5093	HITS-CLIP	24906430
MIRT531294	hsa-miR-664a-3p	PAR-CLIP	22012620
MIRT531293	hsa-miR-572	PAR-CLIP	22012620
MIRT609020	hsa-miR-101-3p	HITS-CLIP	27418678
MIRT648849	hsa-miR-144-3p	HITS-CLIP	27418678
MIRT607118	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT607118	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT607118	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT607117	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT607117	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT607117	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT609019	hsa-miR-3941	HITS-CLIP	27418678
MIRT607116	hsa-miR-5093	HITS-CLIP	27418678
MIRT607116	hsa-miR-5093	HITS-CLIP	27418678
MIRT609021	hsa-miR-603	HITS-CLIP	27418678
MIRT607119	hsa-miR-8485	HITS-CLIP	27418678
MIRT607119	hsa-miR-8485	HITS-CLIP	27418678
MIRT607119	hsa-miR-8485	HITS-CLIP	27418678
MIRT607118	hsa-miR-329-3p	HITS-CLIP	28735896
MIRT607117	hsa-miR-362-3p	HITS-CLIP	28735896
MIRT607116	hsa-miR-5093	HITS-CLIP	28735896
MIRT607119	hsa-miR-8485	HITS-CLIP	28735896
MIRT607119	hsa-miR-8485	HITS-CLIP	23313552
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT607116	hsa-miR-5093	HITS-CLIP	23313552
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT607116	hsa-miR-5093	HITS-CLIP	23313552
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609021	hsa-miR-603	HITS-CLIP	23824327
MIRT609020	hsa-miR-101-3p	HITS-CLIP	23824327
MIRT648849	hsa-miR-144-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT609019	hsa-miR-3941	HITS-CLIP	23824327
MIRT609020	hsa-miR-101-3p	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609021	hsa-miR-603	HITS-CLIP	23824327
MIRT609020	hsa-miR-101-3p	HITS-CLIP	23824327
MIRT648849	hsa-miR-144-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT609019	hsa-miR-3941	HITS-CLIP	23824327
MIRT609020	hsa-miR-101-3p	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609021	hsa-miR-603	HITS-CLIP	23824327
MIRT609020	hsa-miR-101-3p	HITS-CLIP	23824327
MIRT648849	hsa-miR-144-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT609019	hsa-miR-3941	HITS-CLIP	23824327
MIRT609020	hsa-miR-101-3p	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT609021	hsa-miR-603	HITS-CLIP	23824327
MIRT609020	hsa-miR-101-3p	HITS-CLIP	23824327
MIRT648849	hsa-miR-144-3p	HITS-CLIP	23824327
MIRT609019	hsa-miR-3941	HITS-CLIP	23824327
MIRT609020	hsa-miR-101-3p	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT607119	hsa-miR-8485	HITS-CLIP	23824327
MIRT607118	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT607117	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT607116	hsa-miR-5093	HITS-CLIP	23824327
MIRT531294	hsa-miR-664a-3p	PAR-CLIP	22012620
MIRT531293	hsa-miR-572	PAR-CLIP	22012620
MIRT756445	Mir-4723	Luciferase reporter assay, qRT-PCR	35517414
MIRT1493877	hsa-miR-103a	CLIP-seq
MIRT1493878	hsa-miR-107	CLIP-seq
MIRT1493879	hsa-miR-1262	CLIP-seq
MIRT1493880	hsa-miR-15a	CLIP-seq
MIRT1493881	hsa-miR-15b	CLIP-seq
MIRT1493882	hsa-miR-16	CLIP-seq
MIRT1493883	hsa-miR-195	CLIP-seq
MIRT1493884	hsa-miR-424	CLIP-seq
MIRT1493885	hsa-miR-4310	CLIP-seq
MIRT1493886	hsa-miR-4455	CLIP-seq
MIRT1493887	hsa-miR-4701-3p	CLIP-seq
MIRT1493888	hsa-miR-4728-5p	CLIP-seq
MIRT1493889	hsa-miR-497	CLIP-seq
MIRT1493890	hsa-miR-609	CLIP-seq
MIRT2148815	hsa-miR-4270	CLIP-seq
MIRT2148816	hsa-miR-4441	CLIP-seq
MIRT2148817	hsa-miR-4722-3p	CLIP-seq
MIRT2148818	hsa-miR-4755-3p	CLIP-seq
MIRT2148819	hsa-miR-4793-5p	CLIP-seq
MIRT2397028	hsa-miR-298	CLIP-seq
MIRT2397029	hsa-miR-3074-5p	CLIP-seq
MIRT2397030	hsa-miR-3158-5p	CLIP-seq
MIRT2397031	hsa-miR-370	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000578	Process	Embryonic axis specification	IMP	16826533
GO:0001502	Process	Cartilage condensation	IDA	17202865
GO:0001525	Process	Angiogenesis	IEA
GO:0002062	Process	Chondrocyte differentiation	IDA	17202865
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	IPI	12857724
GO:0005102	Function	Signaling receptor binding	NAS	8893824
GO:0005109	Function	Frizzled binding	IBA
GO:0005109	Function	Frizzled binding	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	18986540
GO:0005515	Function	Protein binding	IPI	22784633, 22986341, 26342861, 26908622, 30026314, 32814053, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0007269	Process	Neurotransmitter secretion	IEA
GO:0007409	Process	Axonogenesis	TAS	24449494
GO:0007416	Process	Synapse assembly	IEA
GO:0007548	Process	Sex differentiation	TAS	9790192
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009888	Process	Tissue development	IEA
GO:0009953	Process	Dorsal/ventral pattern formation	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0014719	Process	Skeletal muscle satellite cell activation	IEA
GO:0014834	Process	Skeletal muscle satellite cell maintenance involved in skeletal muscle regeneration	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0021707	Process	Cerebellar granule cell differentiation	IEA
GO:0021846	Process	Cell proliferation in forebrain	IDA	12843296
GO:0022009	Process	Central nervous system vasculogenesis	IEA
GO:0030010	Process	Establishment of cell polarity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030326	Process	Embryonic limb morphogenesis	IEA
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0031012	Component	Extracellular matrix	IEA
GO:0031133	Process	Regulation of axon diameter	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0035115	Process	Embryonic forelimb morphogenesis	IEA
GO:0035115	Process	Embryonic forelimb morphogenesis	IMP	16826533
GO:0035116	Process	Embryonic hindlimb morphogenesis	IEA
GO:0035116	Process	Embryonic hindlimb morphogenesis	IMP	16826533
GO:0035313	Process	Wound healing, spreading of epidermal cells	IDA	15802269
GO:0035567	Process	Non-canonical Wnt signaling pathway	IEA
GO:0036465	Process	Synaptic vesicle recycling	TAS	22988876
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042733	Process	Embryonic digit morphogenesis	IMP	16826533
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043627	Process	Response to estrogen	IEA
GO:0045165	Process	Cell fate commitment	IBA
GO:0045167	Process	Asymmetric protein localization involved in cell fate determination	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	15802269
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12857724
GO:0046330	Process	Positive regulation of JNK cascade	IBA
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0048018	Function	Receptor ligand activity	IC	15802269
GO:0048018	Function	Receptor ligand activity	IDA	18986540, 28733458
GO:0048103	Process	Somatic stem cell division	IEA
GO:0048513	Process	Animal organ development	IEA
GO:0048731	Process	System development	IEA
GO:0048864	Process	Stem cell development	IDA	12843296
GO:0050678	Process	Regulation of epithelial cell proliferation	IEA
GO:0050768	Process	Negative regulation of neurogenesis	IDA	12843296
GO:0050770	Process	Regulation of axonogenesis	IEA
GO:0050808	Process	Synapse organization	IEA
GO:0051216	Process	Cartilage development	IEA
GO:0051247	Process	Positive regulation of protein metabolic process	IDA	16805831
GO:0051965	Process	Positive regulation of synapse assembly	IDA	18986540
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0060054	Process	Positive regulation of epithelial cell proliferation involved in wound healing	IDA	15802269
GO:0060065	Process	Uterus development	IEA
GO:0060066	Process	Oviduct development	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	12857724, 15802269, 16805831, 18986540, 28733458
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	IDA	15802269
GO:0060173	Process	Limb development	IEA
GO:0060856	Process	Establishment of blood-brain barrier	IEA
GO:0060997	Process	Dendritic spine morphogenesis	IDA	21670302
GO:0060997	Process	Dendritic spine morphogenesis	IEA
GO:0061038	Process	Uterus morphogenesis	IEA
GO:0062009	Process	Secondary palate development	IMP	18413325
GO:0070062	Component	Extracellular exosome	TAS
GO:0070307	Process	Lens fiber cell development	ISS	16258938
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEP	15040835
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	EXP	20530549
GO:0098978	Component	Glutamatergic synapse	IDA	20530549
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IMP	20530549
GO:0099054	Process	Presynapse assembly	TAS	24449494
GO:0099068	Process	Postsynapse assembly	TAS	24449494
GO:0099175	Process	Regulation of postsynapse organization	IEA
GO:1904861	Process	Excitatory synapse assembly	TAS	24449494
GO:1904891	Process	Positive regulation of excitatory synapse assembly	IDA	21670302
GO:1905386	Process	Positive regulation of protein localization to presynapse	TAS	24449494
GO:1905606	Process	Regulation of presynapse assembly	EXP	20530549
GO:1905606	Process	Regulation of presynapse assembly	IDA	20530549
GO:1905606	Process	Regulation of presynapse assembly	IMP	20530549
GO:2000300	Process	Regulation of synaptic vesicle exocytosis	IEA
GO:2000463	Process	Positive regulation of excitatory postsynaptic potential	IDA	21670302
GO:2000463	Process	Positive regulation of excitatory postsynaptic potential	IEA

Other IDs

• MIM: 601570
• HGNC: 12786
• e!Ensembl: ENSG00000154764

Protein

• UniProt ID: O00755
• Protein name: Protein Wnt-7a
• Protein function: Ligand for members of the frizzled family of seven transmembrane receptors that functions in the canonical Wnt/beta-catenin signaling pathway (By similarity). Plays an important role in embryonic development, including dorsal versus ventral patt
• PDB: 4UZQ, 8TZO, 8TZP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00110	wnt	40 → 349	wnt family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expression is restricted to placenta, kidney, testis, uterus, fetal lung, and fetal and adult brain.
• Sequence:

  MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
  VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
  AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
  NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
  VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
  ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK

• Sequence length: 349

Pathways

KEGG:

mTOR signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Cushing syndrome
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Human papillomavirus infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Reactome:

WNT ligand biogenesis and trafficking

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Fuhrmann syndrome	Pathogenic; Likely pathogenic	rs104893832, rs387907231	RCV000008527 RCV004821964	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Schinzel phocomelia syndrome	Likely pathogenic; Pathogenic	rs104893835, rs879255548, rs387907231, rs397514643, rs397514666	RCV000008526 RCV000239449 RCV000029192 RCV000033175 RCV000033263	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS 1	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anophthalmia-microphthalmia syndrome	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLADDER EXSTROPHY AND EPISPADIAS COMPLEX	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder exstrophy-epispadias-cloacal extrophy complex	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FEMALE UROGENITAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR SARCOIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Santos syndrome	Conflicting classifications of pathogenicity	ClinVar ClinVar, Disgenet, HPO ClinVar, Disgenet, HPO ClinVar, Disgenet, HPO	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
UROGENITAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WNT7A-related disorder	Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	22313908		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30353687		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22313908		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	29864439		★☆☆☆☆ Found in Text Mining only
Al Awadi syndrome	Al Awadi Syndrome	BEFREE	16826533, 20949531, 23266637, 23727605, 23922166, 27638328, 28917830		★☆☆☆☆ Found in Text Mining only
Al Awadi syndrome	Al Awadi Syndrome	UNIPROT_DG	16826533, 17431918, 20949531, 21271649, 27638328		★☆☆☆☆ Found in Text Mining only
Al Awadi syndrome	Al Awadi Syndrome	GENOMICS_ENGLAND_DG	20949531		★☆☆☆☆ Found in Text Mining only
Al Awadi syndrome	Al Awadi Syndrome	ORPHANET_DG	23266637, 23922166		★☆☆☆☆ Found in Text Mining only
Al Awadi syndrome	Al Awadi Syndrome	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Al Awadi syndrome	Al Awadi Syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	CTD_human_DG	11796754		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	CTD_human_DG	11796754		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	CTD_human_DG	11796754		★☆☆☆☆ Found in Text Mining only
Ankylosis of the elbow joint	Elbow ankylosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
ANONYCHIA	Anonychia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	30361522	Associate	★☆☆☆☆ Found in Text Mining only
Anus, Imperforate	Imperforate anus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	26655831		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29201214		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	18606951	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29549123		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29285041		★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23321718, 26055144	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31886205	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29549123		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11070089, 12937339, 15705594, 23237220, 25653486		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	30361522	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23056560	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22491060	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19849863, 22232518, 25174399, 27195958, 28114283		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	37833902	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	24396035	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	32991049	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25978974		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25978974		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22313908		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	23056560		★☆☆☆☆ Found in Text Mining only
Clinodactyly	Clinodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clubfoot	Clubfoot	Pubtator	18538017	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26055144	Associate	★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	BEFREE	18538017, 19159115		★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	LHGDN	18538017		★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of penis	Congenital Hypoplasia Of Penis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of radius	Congenital Hypoplasia Of Radius	BEFREE	21344627		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of radius	Congenital Hypoplasia Of Radius	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital meningocele	Congenital Meningocele	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital pectus carinatum	Congenital Pectus Carinatum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Corneal dystrophy	Corneal Dystrophy	BEFREE	31271226		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28165497		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29853224		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29853224		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ectrodactyly	Ectrodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	16534752		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	12183078		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23321718	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	31692912, 37144734	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	17140576, 17588571		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	17140576, 17588571	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	17588571		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32319613	Associate	★☆☆☆☆ Found in Text Mining only
Female Urogenital Diseases	Female Urogenital Diseases	CTD_human_DG	16002989		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibroid Tumor	Leiomyoma	BEFREE	11232041		★☆☆☆☆ Found in Text Mining only
Flexion contracture - elbow	Elbow flexion contracture	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	20470940		★☆☆☆☆ Found in Text Mining only
Fuhrmann syndrome	Fuhrmann Syndrome	BEFREE	16826533, 21344627, 23266637, 28917830		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Fuhrmann syndrome	Fuhrmann Syndrome	UNIPROT_DG	16826533		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Fuhrmann syndrome	Fuhrmann Syndrome	GENOMICS_ENGLAND_DG	20949531		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Fuhrmann syndrome	Fuhrmann Syndrome	ORPHANET_DG	23266637, 23922166		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Fuhrmann syndrome	Fuhrmann Syndrome	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Fuhrmann syndrome	Fuhrmann Syndrome	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Fuhrmann syndrome	Fuhrmann Syndrome	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Genitourinary Cancer	Genitourinary Cancer	CTD_human_DG	15751030		★☆☆☆☆ Found in Text Mining only
Genitourinary Neoplasms	Genitourinary Neoplasms	CTD_human_DG	15751030		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29681511, 31271226		★☆☆☆☆ Found in Text Mining only
Hematoma	Hematoma	Pubtator	32991049	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	32991049	Associate	★☆☆☆☆ Found in Text Mining only
Hydrops Fetalis	Hydrops Fetalis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	28434104		★☆☆☆☆ Found in Text Mining only
Hypoplasia of nipple	Hypoplasia Of Nipple	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30361522	Stimulate	★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	32991049	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22313908		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	22313908	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	32458062	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	17767013	Associate	★☆☆☆☆ Found in Text Mining only
Limb Deformities, Congenital	Congenital anomaly of limb	BEFREE	16826533, 18538017, 27638328, 31271226		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	11070089, 12937339, 15705594, 25653486	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12937339, 15705594, 16835228		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	15705594		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23237220	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23321718, 26055144	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30361522	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29285041		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11070089, 12937339, 15705594, 23237220, 25653486		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19849863, 22232518, 25174399, 27195958, 28114283		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	25174399		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31807193		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30867752, 31144375		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29549123		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20470940, 21874048, 29285041, 30353687, 31144375, 31271226		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25978974		★☆☆☆☆ Found in Text Mining only
Meleda Disease	Meleda Disease	BEFREE	28872671		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	11070089		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	11070089	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	25632963	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	30065628		★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Micromelia	Micromelia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	17588571	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	24396035		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	23185011		★☆☆☆☆ Found in Text Mining only
NAIL DISORDER, NONSYNDROMIC CONGENITAL, 9	Nail Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nail dysplasia	Nail dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	28059551	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	26372814		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	26372814	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15705594, 17201809, 20083228, 21874048, 22232518, 22313908, 23056560, 25174399, 25653486, 26372814, 26777421, 31144375, 31271226		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17724465		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15705594, 20501643, 23056560, 25653486		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29853224		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29285041		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	19849863	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19849863, 22232518, 25174399, 27195958, 28114283		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	25174399		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19849863, 27195958	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30361522		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30361522	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33648511	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28456695		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34943986	Associate	★☆☆☆☆ Found in Text Mining only
Phocomelia	Phocomelia	BEFREE	23727605		★☆☆☆☆ Found in Text Mining only
Phocomelia	Phocomelia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Phocomelia, Schinzel type	Phocomelia	Orphanet			★☆☆☆☆ Found in Text Mining only
Polydactyly	Polydactyly	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31807193		★☆☆☆☆ Found in Text Mining only
Ramer Ladda syndrome	Ramer Ladda Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23056560		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	21146388	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	29763843		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37541622	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	30747225		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30867752, 31144375		★☆☆☆☆ Found in Text Mining only
Syndactyly of the toes	Syndactyly Of The Toes	HPO_DG			★☆☆☆☆ Found in Text Mining only
Talipes	Talipes	HPO_DG			★☆☆☆☆ Found in Text Mining only
Taurodontism	Taurodontism	BEFREE	28917830		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	20949531		★☆☆☆☆ Found in Text Mining only
Ulnar polydactyly of fingers	Postaxial hand polydactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24520312, 29549123, 31894304, 36140796	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	25144715, 29510649	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	11232041		★☆☆☆☆ Found in Text Mining only