WNT5A (Wnt family member 5A)

Gene

• Entrez ID: 7474
• Gene name: Wnt family member 5A
• Gene symbol: WNT5A
• Synonyms (NCBI Gene): hWNT5A
• Chromosome: 3
• Chromosome location: 3p14.3
• Summary: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs78756487	AAAAAA>-,AA,AAA,AAAA,AAAAA,AAAAAAA,AAAAAAAA,AAAAAAAAA,AAAAAAAAAA,AAAAAAAAAAA	Uncertain-significance, conflicting-interpretations-of-pathogenicity	3 prime UTR variant
rs181894008	G>A,C,T	Uncertain-significance, conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant
rs387906663	A>G	Pathogenic	Missense variant, coding sequence variant
rs587784562	C>G	Likely-pathogenic	Missense variant, coding sequence variant
rs786200925	C>G	Pathogenic	Missense variant, coding sequence variant
rs786204836	T>C	Pathogenic	Missense variant, coding sequence variant
rs869312850	C>G	Pathogenic	Missense variant, coding sequence variant
rs1553677967	->CCGCAG	Likely-pathogenic	Inframe insertion, coding sequence variant
rs1553677971	G>C	Likely-pathogenic	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005162	hsa-miR-30a-5p	pSILAC	18668040
MIRT020965	hsa-miR-155-5p	Proteomics	20584899
MIRT021154	hsa-miR-186-5p	Sequencing	20371350
MIRT005162	hsa-miR-30a-5p	Proteomics;Other	18668040
MIRT030983	hsa-miR-21-5p	Microarray	18591254
MIRT031969	hsa-miR-16-5p	Proteomics	18668040
MIRT049710	hsa-miR-92a-3p	CLASH	23622248
MIRT053729	hsa-miR-624-3p	Microarray	22942087
MIRT054742	hsa-miR-374a-5p	Luciferase reporter assay, Immunofluorescence analysis, qRT-PCR	24832599
MIRT054742	hsa-miR-374a-5p	Luciferase reporter assay, Immunofluorescence analysis, qRT-PCR	24832599
MIRT437852	hsa-miR-487b-3p	ChIP-seq, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23426183
MIRT437852	hsa-miR-487b-3p	ChIP-seq, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23426183
MIRT437852	hsa-miR-487b-3p	ChIP-seq, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23426183
MIRT437852	hsa-miR-487b-3p	ChIP-seq, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23426183
MIRT163508	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT163408	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT520161	hsa-miR-3924	HITS-CLIP	21572407
MIRT520160	hsa-miR-6083	HITS-CLIP	21572407
MIRT163466	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT163508	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT163408	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT520161	hsa-miR-3924	PAR-CLIP	21572407
MIRT163389	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT520160	hsa-miR-6083	PAR-CLIP	21572407
MIRT163466	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT163508	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT163408	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT520161	hsa-miR-3924	PAR-CLIP	21572407
MIRT520160	hsa-miR-6083	PAR-CLIP	21572407
MIRT163466	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT163508	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT163408	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT520161	hsa-miR-3924	PAR-CLIP	23446348
MIRT520160	hsa-miR-6083	PAR-CLIP	23446348
MIRT163466	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT444479	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT163479	hsa-miR-4307	PAR-CLIP	22100165
MIRT444478	hsa-miR-4427	PAR-CLIP	22100165
MIRT444476	hsa-miR-5187-3p	PAR-CLIP	22100165
MIRT444477	hsa-miR-4680-3p	PAR-CLIP	22100165
MIRT444475	hsa-miR-4635	PAR-CLIP	22100165
MIRT444474	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT444473	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT444472	hsa-miR-4452	PAR-CLIP	22100165
MIRT444471	hsa-miR-4762-3p	PAR-CLIP	22100165
MIRT444470	hsa-miR-578	PAR-CLIP	22100165
MIRT444479	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT163479	hsa-miR-4307	PAR-CLIP	22100165
MIRT444478	hsa-miR-4427	PAR-CLIP	22100165
MIRT444476	hsa-miR-5187-3p	PAR-CLIP	22100165
MIRT444477	hsa-miR-4680-3p	PAR-CLIP	22100165
MIRT444475	hsa-miR-4635	PAR-CLIP	22100165
MIRT444474	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT444473	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT444472	hsa-miR-4452	PAR-CLIP	22100165
MIRT444471	hsa-miR-4762-3p	PAR-CLIP	22100165
MIRT444470	hsa-miR-578	PAR-CLIP	22100165
MIRT439283	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439283	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT726096	hsa-miR-26a-5p	HITS-CLIP	22473208
MIRT726095	hsa-miR-26b-5p	HITS-CLIP	22473208
MIRT731137	hsa-miR-516a-3p	Luciferase reporter assay, qRT-PCR, Western blot	25475098
MIRT731137	hsa-miR-516a-3p	Luciferase reporter assay, qRT-PCR, Western blot	25475098
MIRT731137	hsa-miR-516a-3p	Luciferase reporter assay, qRT-PCR, Western blot	25475098
MIRT731137	hsa-miR-516a-3p	Luciferase reporter assay, qRT-PCR, Western blot	25475098
MIRT731137	hsa-miR-516a-3p	Luciferase reporter assay, qRT-PCR, Western blot	25475098
MIRT731137	hsa-miR-516a-3p	Luciferase reporter assay, qRT-PCR, Western blot	25475098
MIRT731137	hsa-miR-516a-3p	Luciferase reporter assay, qRT-PCR, Western blot	25475098
MIRT731137	hsa-miR-516a-3p	Luciferase reporter assay, qRT-PCR, Western blot	25475098
MIRT733715	hsa-miR-545-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	33928018
MIRT733715	hsa-miR-545-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	33928018
MIRT733717	hsa-miR-1270	Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	33928018
MIRT733717	hsa-miR-1270	Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	33928018
MIRT736847	hsa-miR-493-3p	Western blotting, qRT-PCR	33793074
MIRT163508	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT163408	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT520161	hsa-miR-3924	HITS-CLIP	21572407
MIRT520160	hsa-miR-6083	HITS-CLIP	21572407
MIRT163466	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT163508	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT163408	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT520161	hsa-miR-3924	PAR-CLIP	21572407
MIRT163389	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT520160	hsa-miR-6083	PAR-CLIP	21572407
MIRT163466	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT163508	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT163408	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT520161	hsa-miR-3924	PAR-CLIP	21572407
MIRT520160	hsa-miR-6083	PAR-CLIP	21572407
MIRT163466	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT163508	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT163408	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT520161	hsa-miR-3924	PAR-CLIP	23446348
MIRT520160	hsa-miR-6083	PAR-CLIP	23446348
MIRT163466	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT444479	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT163479	hsa-miR-4307	PAR-CLIP	22100165
MIRT444478	hsa-miR-4427	PAR-CLIP	22100165
MIRT444476	hsa-miR-5187-3p	PAR-CLIP	22100165
MIRT444477	hsa-miR-4680-3p	PAR-CLIP	22100165
MIRT444475	hsa-miR-4635	PAR-CLIP	22100165
MIRT444474	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT444473	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT444472	hsa-miR-4452	PAR-CLIP	22100165
MIRT444471	hsa-miR-4762-3p	PAR-CLIP	22100165
MIRT444470	hsa-miR-578	PAR-CLIP	22100165
MIRT444479	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT163479	hsa-miR-4307	PAR-CLIP	22100165
MIRT444478	hsa-miR-4427	PAR-CLIP	22100165
MIRT444476	hsa-miR-5187-3p	PAR-CLIP	22100165
MIRT444477	hsa-miR-4680-3p	PAR-CLIP	22100165
MIRT444475	hsa-miR-4635	PAR-CLIP	22100165
MIRT444474	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT444473	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT444472	hsa-miR-4452	PAR-CLIP	22100165
MIRT444471	hsa-miR-4762-3p	PAR-CLIP	22100165
MIRT444470	hsa-miR-578	PAR-CLIP	22100165
MIRT756276	hsa-miR-4757-3p	Luciferase reporter assay, Western blotting, qRT-PCR	36814555
MIRT1493815	hsa-miR-1293	CLIP-seq
MIRT1493816	hsa-miR-133a	CLIP-seq
MIRT1493817	hsa-miR-133b	CLIP-seq
MIRT1493818	hsa-miR-198	CLIP-seq
MIRT1493819	hsa-miR-219-2-3p	CLIP-seq
MIRT1493820	hsa-miR-2964a-3p	CLIP-seq
MIRT1493821	hsa-miR-3663-5p	CLIP-seq
MIRT1493822	hsa-miR-376a	CLIP-seq
MIRT1493823	hsa-miR-376b	CLIP-seq
MIRT1493824	hsa-miR-4422	CLIP-seq
MIRT1493825	hsa-miR-4483	CLIP-seq
MIRT1493826	hsa-miR-4508	CLIP-seq
MIRT1493827	hsa-miR-455-5p	CLIP-seq
MIRT1493828	hsa-miR-4656	CLIP-seq
MIRT1493829	hsa-miR-4696	CLIP-seq
MIRT1493830	hsa-miR-4731-5p	CLIP-seq
MIRT1493831	hsa-miR-512-3p	CLIP-seq
MIRT1493832	hsa-miR-545	CLIP-seq
MIRT2148800	hsa-miR-3198	CLIP-seq
MIRT2148801	hsa-miR-3664-5p	CLIP-seq
MIRT2148802	hsa-miR-3679-3p	CLIP-seq
MIRT2148803	hsa-miR-4303	CLIP-seq
MIRT2148804	hsa-miR-4309	CLIP-seq
MIRT2148805	hsa-miR-432	CLIP-seq
MIRT2148806	hsa-miR-4480	CLIP-seq
MIRT2148807	hsa-miR-4653-3p	CLIP-seq
MIRT2148808	hsa-miR-4662a-5p	CLIP-seq
MIRT2148809	hsa-miR-4682	CLIP-seq
MIRT2148810	hsa-miR-4699-3p	CLIP-seq
MIRT2148811	hsa-miR-4714-5p	CLIP-seq
MIRT2148812	hsa-miR-496	CLIP-seq
MIRT2148813	hsa-miR-628-5p	CLIP-seq
MIRT2148814	hsa-miR-759	CLIP-seq
MIRT2369203	hsa-miR-1178	CLIP-seq
MIRT2369204	hsa-miR-1231	CLIP-seq
MIRT2369205	hsa-miR-1257	CLIP-seq
MIRT2369206	hsa-miR-183	CLIP-seq
MIRT2369207	hsa-miR-4288	CLIP-seq
MIRT2369208	hsa-miR-4420	CLIP-seq
MIRT2369209	hsa-miR-452	CLIP-seq
MIRT2148808	hsa-miR-4662a-5p	CLIP-seq
MIRT2369210	hsa-miR-4676-3p	CLIP-seq
MIRT2369211	hsa-miR-4677-3p	CLIP-seq
MIRT2369212	hsa-miR-4679	CLIP-seq
MIRT2369213	hsa-miR-4772-3p	CLIP-seq
MIRT2369214	hsa-miR-4790-3p	CLIP-seq
MIRT1493831	hsa-miR-512-3p	CLIP-seq
MIRT2369215	hsa-miR-548q	CLIP-seq
MIRT2369216	hsa-miR-632	CLIP-seq
MIRT2369217	hsa-miR-885-5p	CLIP-seq
MIRT2369218	hsa-miR-891b	CLIP-seq
MIRT2148801	hsa-miR-3664-5p	CLIP-seq
MIRT2148810	hsa-miR-4699-3p	CLIP-seq
MIRT2148811	hsa-miR-4714-5p	CLIP-seq
MIRT2148812	hsa-miR-496	CLIP-seq
MIRT2148814	hsa-miR-759	CLIP-seq
MIRT2434717	hsa-miR-1184	CLIP-seq
MIRT2434718	hsa-miR-1205	CLIP-seq
MIRT2434719	hsa-miR-1237	CLIP-seq
MIRT2369205	hsa-miR-1257	CLIP-seq
MIRT2434720	hsa-miR-1261	CLIP-seq
MIRT2434721	hsa-miR-1264	CLIP-seq
MIRT2434722	hsa-miR-1272	CLIP-seq
MIRT2434723	hsa-miR-1292	CLIP-seq
MIRT2434724	hsa-miR-1297	CLIP-seq
MIRT2434725	hsa-miR-1298	CLIP-seq
MIRT2434726	hsa-miR-1299	CLIP-seq
MIRT2434727	hsa-miR-1305	CLIP-seq
MIRT2434728	hsa-miR-132	CLIP-seq
MIRT2434729	hsa-miR-1322	CLIP-seq
MIRT2434730	hsa-miR-155	CLIP-seq
MIRT2434731	hsa-miR-15a	CLIP-seq
MIRT2434732	hsa-miR-15b	CLIP-seq
MIRT2434733	hsa-miR-16	CLIP-seq
MIRT2434734	hsa-miR-195	CLIP-seq
MIRT2434735	hsa-miR-2110	CLIP-seq
MIRT2434736	hsa-miR-212	CLIP-seq
MIRT2434737	hsa-miR-2355-3p	CLIP-seq
MIRT2434738	hsa-miR-26a	CLIP-seq
MIRT2434739	hsa-miR-26b	CLIP-seq
MIRT2434740	hsa-miR-298	CLIP-seq
MIRT2434741	hsa-miR-300	CLIP-seq
MIRT2434742	hsa-miR-3064-5p	CLIP-seq
MIRT2434743	hsa-miR-3074-3p	CLIP-seq
MIRT2434744	hsa-miR-3121-3p	CLIP-seq
MIRT2434745	hsa-miR-3140-3p	CLIP-seq
MIRT2434746	hsa-miR-3152-3p	CLIP-seq
MIRT2434747	hsa-miR-3156-5p	CLIP-seq
MIRT2434748	hsa-miR-3158-5p	CLIP-seq
MIRT2434749	hsa-miR-3160-5p	CLIP-seq
MIRT2434750	hsa-miR-3163	CLIP-seq
MIRT2434751	hsa-miR-3173-5p	CLIP-seq
MIRT2434752	hsa-miR-3177-5p	CLIP-seq
MIRT2434753	hsa-miR-323-3p	CLIP-seq
MIRT2434754	hsa-miR-338-5p	CLIP-seq
MIRT2434755	hsa-miR-340	CLIP-seq
MIRT2434756	hsa-miR-34b	CLIP-seq
MIRT2434757	hsa-miR-3607-3p	CLIP-seq
MIRT2434758	hsa-miR-3609	CLIP-seq
MIRT2434759	hsa-miR-3622b-5p	CLIP-seq
MIRT2434760	hsa-miR-3647-3p	CLIP-seq
MIRT2434761	hsa-miR-365	CLIP-seq
MIRT2434762	hsa-miR-3655	CLIP-seq
MIRT2434763	hsa-miR-3667-3p	CLIP-seq
MIRT2434764	hsa-miR-3668	CLIP-seq
MIRT2434765	hsa-miR-3675-3p	CLIP-seq
MIRT2148802	hsa-miR-3679-3p	CLIP-seq
MIRT2434766	hsa-miR-3681	CLIP-seq
MIRT2434767	hsa-miR-370	CLIP-seq
MIRT2434768	hsa-miR-371b-5p	CLIP-seq
MIRT2434769	hsa-miR-376c	CLIP-seq
MIRT2434770	hsa-miR-381	CLIP-seq
MIRT2434771	hsa-miR-3919	CLIP-seq
MIRT2434772	hsa-miR-3978	CLIP-seq
MIRT2434773	hsa-miR-424	CLIP-seq
MIRT2434774	hsa-miR-4263	CLIP-seq
MIRT2434775	hsa-miR-4268	CLIP-seq
MIRT2434776	hsa-miR-4269	CLIP-seq
MIRT2434777	hsa-miR-4271	CLIP-seq
MIRT2434778	hsa-miR-4290	CLIP-seq
MIRT2434779	hsa-miR-4305	CLIP-seq
MIRT2434780	hsa-miR-4310	CLIP-seq
MIRT2434781	hsa-miR-4328	CLIP-seq
MIRT2434782	hsa-miR-4434	CLIP-seq
MIRT2434783	hsa-miR-4448	CLIP-seq
MIRT2434784	hsa-miR-4465	CLIP-seq
MIRT2434785	hsa-miR-4471	CLIP-seq
MIRT2434786	hsa-miR-4477a	CLIP-seq
MIRT2434787	hsa-miR-4477b	CLIP-seq
MIRT2148806	hsa-miR-4480	CLIP-seq
MIRT2434788	hsa-miR-4481	CLIP-seq
MIRT2434789	hsa-miR-4514	CLIP-seq
MIRT2434790	hsa-miR-4516	CLIP-seq
MIRT2434791	hsa-miR-4524	CLIP-seq
MIRT2434792	hsa-miR-4646-5p	CLIP-seq
MIRT2148808	hsa-miR-4662a-5p	CLIP-seq
MIRT2434793	hsa-miR-4666-3p	CLIP-seq
MIRT2434794	hsa-miR-4666-5p	CLIP-seq
MIRT2434795	hsa-miR-4667-5p	CLIP-seq
MIRT2434796	hsa-miR-4692	CLIP-seq
MIRT2434797	hsa-miR-4698	CLIP-seq
MIRT2434798	hsa-miR-4700-5p	CLIP-seq
MIRT2434799	hsa-miR-4716-5p	CLIP-seq
MIRT2434800	hsa-miR-4724-3p	CLIP-seq
MIRT2434801	hsa-miR-4725-3p	CLIP-seq
MIRT1493830	hsa-miR-4731-5p	CLIP-seq
MIRT2434802	hsa-miR-4742-5p	CLIP-seq
MIRT2434803	hsa-miR-4745-5p	CLIP-seq
MIRT2434804	hsa-miR-4747-5p	CLIP-seq
MIRT2434805	hsa-miR-4758-5p	CLIP-seq
MIRT2434806	hsa-miR-4760-3p	CLIP-seq
MIRT2434807	hsa-miR-4764-5p	CLIP-seq
MIRT2369213	hsa-miR-4772-3p	CLIP-seq
MIRT2434808	hsa-miR-4782-5p	CLIP-seq
MIRT2434809	hsa-miR-4796-5p	CLIP-seq
MIRT2434810	hsa-miR-4799-5p	CLIP-seq
MIRT2434811	hsa-miR-497	CLIP-seq
MIRT2434812	hsa-miR-503	CLIP-seq
MIRT2434813	hsa-miR-516b	CLIP-seq
MIRT2434814	hsa-miR-520g	CLIP-seq
MIRT2434815	hsa-miR-520h	CLIP-seq
MIRT2434816	hsa-miR-539	CLIP-seq
MIRT2434817	hsa-miR-544	CLIP-seq
MIRT1493832	hsa-miR-545	CLIP-seq
MIRT2434818	hsa-miR-548ag	CLIP-seq
MIRT2434819	hsa-miR-548ah	CLIP-seq
MIRT2434820	hsa-miR-548ai	CLIP-seq
MIRT2434821	hsa-miR-548g	CLIP-seq
MIRT2434822	hsa-miR-548n	CLIP-seq
MIRT2434823	hsa-miR-548t	CLIP-seq
MIRT2434824	hsa-miR-556-3p	CLIP-seq
MIRT2434825	hsa-miR-576-3p	CLIP-seq
MIRT2434826	hsa-miR-576-5p	CLIP-seq
MIRT2434827	hsa-miR-587	CLIP-seq
MIRT2434828	hsa-miR-604	CLIP-seq
MIRT2434829	hsa-miR-606	CLIP-seq
MIRT2434830	hsa-miR-607	CLIP-seq
MIRT2434831	hsa-miR-616	CLIP-seq
MIRT2434832	hsa-miR-621	CLIP-seq
MIRT2434833	hsa-miR-629	CLIP-seq
MIRT2434834	hsa-miR-643	CLIP-seq
MIRT2434835	hsa-miR-646	CLIP-seq
MIRT2434836	hsa-miR-647	CLIP-seq
MIRT2434837	hsa-miR-660	CLIP-seq
MIRT2434838	hsa-miR-676	CLIP-seq
MIRT2434839	hsa-miR-767-5p	CLIP-seq
MIRT2369217	hsa-miR-885-5p	CLIP-seq
MIRT2369218	hsa-miR-891b	CLIP-seq
MIRT2434840	hsa-miR-892b	CLIP-seq
MIRT2441685	hsa-miR-1266	CLIP-seq
MIRT2441686	hsa-miR-128	CLIP-seq
MIRT2441687	hsa-miR-199a-3p	CLIP-seq
MIRT2441688	hsa-miR-199b-3p	CLIP-seq
MIRT2434744	hsa-miR-3121-3p	CLIP-seq
MIRT2441689	hsa-miR-3129-5p	CLIP-seq
MIRT2434753	hsa-miR-323-3p	CLIP-seq
MIRT2441690	hsa-miR-3664-3p	CLIP-seq
MIRT2434764	hsa-miR-3668	CLIP-seq
MIRT2441691	hsa-miR-3941	CLIP-seq
MIRT2441692	hsa-miR-421	CLIP-seq
MIRT2441693	hsa-miR-4433	CLIP-seq
MIRT2441694	hsa-miR-4459	CLIP-seq
MIRT2441695	hsa-miR-4518	CLIP-seq
MIRT2441696	hsa-miR-466	CLIP-seq
MIRT2441697	hsa-miR-4672	CLIP-seq
MIRT2441698	hsa-miR-4709-5p	CLIP-seq
MIRT2441699	hsa-miR-4768-3p	CLIP-seq
MIRT2441700	hsa-miR-494	CLIP-seq
MIRT2434821	hsa-miR-548g	CLIP-seq
MIRT2441701	hsa-miR-577	CLIP-seq
MIRT2441702	hsa-miR-936	CLIP-seq
MIRT2434720	hsa-miR-1261	CLIP-seq
MIRT2463542	hsa-miR-22	CLIP-seq
MIRT2463543	hsa-miR-3130-5p	CLIP-seq
MIRT2463544	hsa-miR-3144-5p	CLIP-seq
MIRT2463545	hsa-miR-338-3p	CLIP-seq
MIRT2434766	hsa-miR-3681	CLIP-seq
MIRT2434782	hsa-miR-4434	CLIP-seq
MIRT2463546	hsa-miR-4435	CLIP-seq
MIRT2434788	hsa-miR-4481	CLIP-seq
MIRT2463547	hsa-miR-4482	CLIP-seq
MIRT2434790	hsa-miR-4516	CLIP-seq
MIRT2463548	hsa-miR-4633-3p	CLIP-seq
MIRT2434803	hsa-miR-4745-5p	CLIP-seq
MIRT2434805	hsa-miR-4758-5p	CLIP-seq
MIRT2463549	hsa-miR-499-3p	CLIP-seq
MIRT2463550	hsa-miR-499a-3p	CLIP-seq
MIRT2463551	hsa-miR-558	CLIP-seq
MIRT2434830	hsa-miR-607	CLIP-seq
MIRT2463552	hsa-miR-711	CLIP-seq
MIRT2463545	hsa-miR-338-3p	CLIP-seq
MIRT2148803	hsa-miR-4303	CLIP-seq
MIRT2463546	hsa-miR-4435	CLIP-seq
MIRT2148809	hsa-miR-4682	CLIP-seq
MIRT2441700	hsa-miR-494	CLIP-seq
MIRT2463549	hsa-miR-499-3p	CLIP-seq
MIRT2463550	hsa-miR-499a-3p	CLIP-seq
MIRT2434830	hsa-miR-607	CLIP-seq
MIRT2148813	hsa-miR-628-5p	CLIP-seq
MIRT2662774	hsa-miR-106a	CLIP-seq
MIRT2662775	hsa-miR-106b	CLIP-seq
MIRT2369203	hsa-miR-1178	CLIP-seq
MIRT2434717	hsa-miR-1184	CLIP-seq
MIRT2434718	hsa-miR-1205	CLIP-seq
MIRT2662776	hsa-miR-1208	CLIP-seq
MIRT2662777	hsa-miR-1236	CLIP-seq
MIRT2662778	hsa-miR-1243	CLIP-seq
MIRT2369205	hsa-miR-1257	CLIP-seq
MIRT2434721	hsa-miR-1264	CLIP-seq
MIRT2441685	hsa-miR-1266	CLIP-seq
MIRT2662779	hsa-miR-1269	CLIP-seq
MIRT2662780	hsa-miR-1269b	CLIP-seq
MIRT2662781	hsa-miR-1271	CLIP-seq
MIRT2434722	hsa-miR-1272	CLIP-seq
MIRT2662782	hsa-miR-1273e	CLIP-seq
MIRT2662783	hsa-miR-1276	CLIP-seq
MIRT2662784	hsa-miR-1279	CLIP-seq
MIRT2441686	hsa-miR-128	CLIP-seq
MIRT2662785	hsa-miR-1288	CLIP-seq
MIRT2662786	hsa-miR-129-5p	CLIP-seq
MIRT2434724	hsa-miR-1297	CLIP-seq
MIRT2662787	hsa-miR-1321	CLIP-seq
MIRT2434729	hsa-miR-1322	CLIP-seq
MIRT2662788	hsa-miR-141	CLIP-seq
MIRT2662789	hsa-miR-146a	CLIP-seq
MIRT2662790	hsa-miR-146b-5p	CLIP-seq
MIRT2662791	hsa-miR-147	CLIP-seq
MIRT2662792	hsa-miR-1587	CLIP-seq
MIRT2434731	hsa-miR-15a	CLIP-seq
MIRT2434732	hsa-miR-15b	CLIP-seq
MIRT2434733	hsa-miR-16	CLIP-seq
MIRT2662793	hsa-miR-17	CLIP-seq
MIRT2662794	hsa-miR-182	CLIP-seq
MIRT2662795	hsa-miR-186	CLIP-seq
MIRT2662796	hsa-miR-188-5p	CLIP-seq
MIRT2662797	hsa-miR-1914	CLIP-seq
MIRT2434734	hsa-miR-195	CLIP-seq
MIRT2441687	hsa-miR-199a-3p	CLIP-seq
MIRT2441688	hsa-miR-199b-3p	CLIP-seq
MIRT2662798	hsa-miR-200a	CLIP-seq
MIRT2662799	hsa-miR-2052	CLIP-seq
MIRT2662800	hsa-miR-2053	CLIP-seq
MIRT2662801	hsa-miR-20a	CLIP-seq
MIRT2662802	hsa-miR-20b	CLIP-seq
MIRT2434735	hsa-miR-2110	CLIP-seq
MIRT2662803	hsa-miR-2113	CLIP-seq
MIRT2434737	hsa-miR-2355-3p	CLIP-seq
MIRT2434738	hsa-miR-26a	CLIP-seq
MIRT2434739	hsa-miR-26b	CLIP-seq
MIRT2434740	hsa-miR-298	CLIP-seq
MIRT2434741	hsa-miR-300	CLIP-seq
MIRT2434742	hsa-miR-3064-5p	CLIP-seq
MIRT2662804	hsa-miR-3117-5p	CLIP-seq
MIRT2434744	hsa-miR-3121-3p	CLIP-seq
MIRT2662805	hsa-miR-3129-3p	CLIP-seq
MIRT2441689	hsa-miR-3129-5p	CLIP-seq
MIRT2662806	hsa-miR-3133	CLIP-seq
MIRT2662807	hsa-miR-3138	CLIP-seq
MIRT2434745	hsa-miR-3140-3p	CLIP-seq
MIRT2662808	hsa-miR-3148	CLIP-seq
MIRT2662809	hsa-miR-3149	CLIP-seq
MIRT2434747	hsa-miR-3156-5p	CLIP-seq
MIRT2434748	hsa-miR-3158-5p	CLIP-seq
MIRT2662810	hsa-miR-3159	CLIP-seq
MIRT2434749	hsa-miR-3160-5p	CLIP-seq
MIRT2662811	hsa-miR-3161	CLIP-seq
MIRT2434750	hsa-miR-3163	CLIP-seq
MIRT2434751	hsa-miR-3173-5p	CLIP-seq
MIRT2662812	hsa-miR-3190	CLIP-seq
MIRT2148800	hsa-miR-3198	CLIP-seq
MIRT2662813	hsa-miR-3200-3p	CLIP-seq
MIRT2662814	hsa-miR-3200-5p	CLIP-seq
MIRT2662815	hsa-miR-3202	CLIP-seq
MIRT2434753	hsa-miR-323-3p	CLIP-seq
MIRT2662816	hsa-miR-33a	CLIP-seq
MIRT2662817	hsa-miR-33b	CLIP-seq
MIRT2434756	hsa-miR-34b	CLIP-seq
MIRT2434757	hsa-miR-3607-3p	CLIP-seq
MIRT2434758	hsa-miR-3609	CLIP-seq
MIRT2434759	hsa-miR-3622b-5p	CLIP-seq
MIRT2434760	hsa-miR-3647-3p	CLIP-seq
MIRT2434761	hsa-miR-365	CLIP-seq
MIRT2434762	hsa-miR-3655	CLIP-seq
MIRT2441690	hsa-miR-3664-3p	CLIP-seq
MIRT2148801	hsa-miR-3664-5p	CLIP-seq
MIRT2434763	hsa-miR-3667-3p	CLIP-seq
MIRT2434764	hsa-miR-3668	CLIP-seq
MIRT2434765	hsa-miR-3675-3p	CLIP-seq
MIRT2662818	hsa-miR-3677-5p	CLIP-seq
MIRT2662819	hsa-miR-3684	CLIP-seq
MIRT2662820	hsa-miR-369-3p	CLIP-seq
MIRT2434767	hsa-miR-370	CLIP-seq
MIRT2662821	hsa-miR-374a	CLIP-seq
MIRT2662822	hsa-miR-374b	CLIP-seq
MIRT2434770	hsa-miR-381	CLIP-seq
MIRT2662823	hsa-miR-3915	CLIP-seq
MIRT2434771	hsa-miR-3919	CLIP-seq
MIRT2662824	hsa-miR-3920	CLIP-seq
MIRT2662825	hsa-miR-3928	CLIP-seq
MIRT2441691	hsa-miR-3941	CLIP-seq
MIRT2662826	hsa-miR-3977	CLIP-seq
MIRT2434772	hsa-miR-3978	CLIP-seq
MIRT2662827	hsa-miR-409-3p	CLIP-seq
MIRT2441692	hsa-miR-421	CLIP-seq
MIRT2434773	hsa-miR-424	CLIP-seq
MIRT2662828	hsa-miR-4251	CLIP-seq
MIRT2434774	hsa-miR-4263	CLIP-seq
MIRT2662829	hsa-miR-4265	CLIP-seq
MIRT2434777	hsa-miR-4271	CLIP-seq
MIRT2662830	hsa-miR-4275	CLIP-seq
MIRT2434778	hsa-miR-4290	CLIP-seq
MIRT2662831	hsa-miR-4296	CLIP-seq
MIRT2662832	hsa-miR-4297	CLIP-seq
MIRT2148803	hsa-miR-4303	CLIP-seq
MIRT2434779	hsa-miR-4305	CLIP-seq
MIRT2148804	hsa-miR-4309	CLIP-seq
MIRT2434780	hsa-miR-4310	CLIP-seq
MIRT2662833	hsa-miR-4311	CLIP-seq
MIRT2148805	hsa-miR-432	CLIP-seq
MIRT2662834	hsa-miR-4322	CLIP-seq
MIRT2662835	hsa-miR-4417	CLIP-seq
MIRT2369208	hsa-miR-4420	CLIP-seq
MIRT2441693	hsa-miR-4433	CLIP-seq
MIRT2662836	hsa-miR-4445	CLIP-seq
MIRT2662837	hsa-miR-4446-5p	CLIP-seq
MIRT2441694	hsa-miR-4459	CLIP-seq
MIRT2662838	hsa-miR-4464	CLIP-seq
MIRT2434784	hsa-miR-4465	CLIP-seq
MIRT2662839	hsa-miR-4470	CLIP-seq
MIRT2662840	hsa-miR-4473	CLIP-seq
MIRT2434786	hsa-miR-4477a	CLIP-seq
MIRT2662841	hsa-miR-4492	CLIP-seq
MIRT2662842	hsa-miR-4498	CLIP-seq
MIRT2662843	hsa-miR-450b-5p	CLIP-seq
MIRT2662844	hsa-miR-4515	CLIP-seq
MIRT2441695	hsa-miR-4518	CLIP-seq
MIRT2369209	hsa-miR-452	CLIP-seq
MIRT2434791	hsa-miR-4524	CLIP-seq
MIRT2662845	hsa-miR-4527	CLIP-seq
MIRT2662846	hsa-miR-4637	CLIP-seq
MIRT2662847	hsa-miR-4640-5p	CLIP-seq
MIRT2662848	hsa-miR-4642	CLIP-seq
MIRT2148807	hsa-miR-4653-3p	CLIP-seq
MIRT1493828	hsa-miR-4656	CLIP-seq
MIRT2441696	hsa-miR-466	CLIP-seq
MIRT2434793	hsa-miR-4666-3p	CLIP-seq
MIRT2434795	hsa-miR-4667-5p	CLIP-seq
MIRT2662849	hsa-miR-4671-3p	CLIP-seq
MIRT2441697	hsa-miR-4672	CLIP-seq
MIRT2662850	hsa-miR-4674	CLIP-seq
MIRT2662851	hsa-miR-4675	CLIP-seq
MIRT2369210	hsa-miR-4676-3p	CLIP-seq
MIRT2148809	hsa-miR-4682	CLIP-seq
MIRT2148810	hsa-miR-4699-3p	CLIP-seq
MIRT2434798	hsa-miR-4700-5p	CLIP-seq
MIRT2441698	hsa-miR-4709-5p	CLIP-seq
MIRT2148811	hsa-miR-4714-5p	CLIP-seq
MIRT2434799	hsa-miR-4716-5p	CLIP-seq
MIRT2434800	hsa-miR-4724-3p	CLIP-seq
MIRT2434801	hsa-miR-4725-3p	CLIP-seq
MIRT2662852	hsa-miR-4726-5p	CLIP-seq
MIRT1493830	hsa-miR-4731-5p	CLIP-seq
MIRT2662853	hsa-miR-4738-3p	CLIP-seq
MIRT2662854	hsa-miR-4739	CLIP-seq
MIRT2662855	hsa-miR-4740-5p	CLIP-seq
MIRT2662856	hsa-miR-4741	CLIP-seq
MIRT2434804	hsa-miR-4747-5p	CLIP-seq
MIRT2662857	hsa-miR-4748	CLIP-seq
MIRT2662858	hsa-miR-4752	CLIP-seq
MIRT2662859	hsa-miR-4756-5p	CLIP-seq
MIRT2434806	hsa-miR-4760-3p	CLIP-seq
MIRT2662860	hsa-miR-4766-3p	CLIP-seq
MIRT2441699	hsa-miR-4768-3p	CLIP-seq
MIRT2369213	hsa-miR-4772-3p	CLIP-seq
MIRT2662861	hsa-miR-4778-3p	CLIP-seq
MIRT2662862	hsa-miR-4781-3p	CLIP-seq
MIRT2369214	hsa-miR-4790-3p	CLIP-seq
MIRT2662863	hsa-miR-4793-5p	CLIP-seq
MIRT2662864	hsa-miR-4795-3p	CLIP-seq
MIRT2662865	hsa-miR-4796-3p	CLIP-seq
MIRT2434809	hsa-miR-4796-5p	CLIP-seq
MIRT2434810	hsa-miR-4799-5p	CLIP-seq
MIRT2662866	hsa-miR-4800-3p	CLIP-seq
MIRT2662867	hsa-miR-4800-5p	CLIP-seq
MIRT2662868	hsa-miR-487a	CLIP-seq
MIRT2441700	hsa-miR-494	CLIP-seq
MIRT2148812	hsa-miR-496	CLIP-seq
MIRT2434811	hsa-miR-497	CLIP-seq
MIRT2662869	hsa-miR-498	CLIP-seq
MIRT2434812	hsa-miR-503	CLIP-seq
MIRT2662870	hsa-miR-507	CLIP-seq
MIRT1493831	hsa-miR-512-3p	CLIP-seq
MIRT2662871	hsa-miR-515-5p	CLIP-seq
MIRT2662872	hsa-miR-517a	CLIP-seq
MIRT2662873	hsa-miR-517c	CLIP-seq
MIRT2662874	hsa-miR-519d	CLIP-seq
MIRT2662875	hsa-miR-520f	CLIP-seq
MIRT2434816	hsa-miR-539	CLIP-seq
MIRT2434817	hsa-miR-544	CLIP-seq
MIRT2662876	hsa-miR-548a-3p	CLIP-seq
MIRT2662877	hsa-miR-548aa	CLIP-seq
MIRT2662878	hsa-miR-548ac	CLIP-seq
MIRT2662879	hsa-miR-548ae	CLIP-seq
MIRT2434819	hsa-miR-548ah	CLIP-seq
MIRT2662880	hsa-miR-548aj	CLIP-seq
MIRT2662881	hsa-miR-548am	CLIP-seq
MIRT2662882	hsa-miR-548c-3p	CLIP-seq
MIRT2662883	hsa-miR-548d-3p	CLIP-seq
MIRT2662884	hsa-miR-548e	CLIP-seq
MIRT2662885	hsa-miR-548f	CLIP-seq
MIRT2434821	hsa-miR-548g	CLIP-seq
MIRT2662886	hsa-miR-548k	CLIP-seq
MIRT2434822	hsa-miR-548n	CLIP-seq
MIRT2662887	hsa-miR-548p	CLIP-seq
MIRT2434823	hsa-miR-548t	CLIP-seq
MIRT2662888	hsa-miR-548x	CLIP-seq
MIRT2662889	hsa-miR-548z	CLIP-seq
MIRT2662890	hsa-miR-550a	CLIP-seq
MIRT2662891	hsa-miR-557	CLIP-seq
MIRT2662892	hsa-miR-561	CLIP-seq
MIRT2662893	hsa-miR-564	CLIP-seq
MIRT2662894	hsa-miR-568	CLIP-seq
MIRT2434825	hsa-miR-576-3p	CLIP-seq
MIRT2434826	hsa-miR-576-5p	CLIP-seq
MIRT2441701	hsa-miR-577	CLIP-seq
MIRT2662895	hsa-miR-580	CLIP-seq
MIRT2662896	hsa-miR-583	CLIP-seq
MIRT2662897	hsa-miR-586	CLIP-seq
MIRT2434827	hsa-miR-587	CLIP-seq
MIRT2662898	hsa-miR-589	CLIP-seq
MIRT2662899	hsa-miR-595	CLIP-seq
MIRT2662900	hsa-miR-599	CLIP-seq
MIRT2434828	hsa-miR-604	CLIP-seq
MIRT2434829	hsa-miR-606	CLIP-seq
MIRT2434831	hsa-miR-616	CLIP-seq
MIRT2434832	hsa-miR-621	CLIP-seq
MIRT2662901	hsa-miR-624	CLIP-seq
MIRT2148813	hsa-miR-628-5p	CLIP-seq
MIRT2434833	hsa-miR-629	CLIP-seq
MIRT2662902	hsa-miR-635	CLIP-seq
MIRT2434835	hsa-miR-646	CLIP-seq
MIRT2434836	hsa-miR-647	CLIP-seq
MIRT2662903	hsa-miR-649	CLIP-seq
MIRT2434837	hsa-miR-660	CLIP-seq
MIRT2434838	hsa-miR-676	CLIP-seq
MIRT2148814	hsa-miR-759	CLIP-seq
MIRT2662904	hsa-miR-762	CLIP-seq
MIRT2369218	hsa-miR-891b	CLIP-seq
MIRT2434840	hsa-miR-892b	CLIP-seq
MIRT2662905	hsa-miR-93	CLIP-seq
MIRT2441702	hsa-miR-936	CLIP-seq
MIRT2662906	hsa-miR-96	CLIP-seq
MIRT2662774	hsa-miR-106a	CLIP-seq
MIRT2662775	hsa-miR-106b	CLIP-seq
MIRT2369203	hsa-miR-1178	CLIP-seq
MIRT2434717	hsa-miR-1184	CLIP-seq
MIRT2434718	hsa-miR-1205	CLIP-seq
MIRT2662776	hsa-miR-1208	CLIP-seq
MIRT2662777	hsa-miR-1236	CLIP-seq
MIRT2695258	hsa-miR-1238	CLIP-seq
MIRT2662778	hsa-miR-1243	CLIP-seq
MIRT2695259	hsa-miR-1252	CLIP-seq
MIRT2369205	hsa-miR-1257	CLIP-seq
MIRT2434721	hsa-miR-1264	CLIP-seq
MIRT2441685	hsa-miR-1266	CLIP-seq
MIRT2662779	hsa-miR-1269	CLIP-seq
MIRT2662780	hsa-miR-1269b	CLIP-seq
MIRT2662781	hsa-miR-1271	CLIP-seq
MIRT2434722	hsa-miR-1272	CLIP-seq
MIRT2662782	hsa-miR-1273e	CLIP-seq
MIRT2662783	hsa-miR-1276	CLIP-seq
MIRT2662784	hsa-miR-1279	CLIP-seq
MIRT2441686	hsa-miR-128	CLIP-seq
MIRT2662786	hsa-miR-129-5p	CLIP-seq
MIRT2434724	hsa-miR-1297	CLIP-seq
MIRT2434725	hsa-miR-1298	CLIP-seq
MIRT2662787	hsa-miR-1321	CLIP-seq
MIRT2434729	hsa-miR-1322	CLIP-seq
MIRT2662788	hsa-miR-141	CLIP-seq
MIRT2662789	hsa-miR-146a	CLIP-seq
MIRT2662790	hsa-miR-146b-5p	CLIP-seq
MIRT2662791	hsa-miR-147	CLIP-seq
MIRT2695260	hsa-miR-154	CLIP-seq
MIRT2662792	hsa-miR-1587	CLIP-seq
MIRT2434731	hsa-miR-15a	CLIP-seq
MIRT2434732	hsa-miR-15b	CLIP-seq
MIRT2434733	hsa-miR-16	CLIP-seq
MIRT2662793	hsa-miR-17	CLIP-seq
MIRT2662794	hsa-miR-182	CLIP-seq
MIRT2662795	hsa-miR-186	CLIP-seq
MIRT2662796	hsa-miR-188-5p	CLIP-seq
MIRT2695261	hsa-miR-190	CLIP-seq
MIRT2695262	hsa-miR-190b	CLIP-seq
MIRT2662797	hsa-miR-1914	CLIP-seq
MIRT2434734	hsa-miR-195	CLIP-seq
MIRT2441687	hsa-miR-199a-3p	CLIP-seq
MIRT2441688	hsa-miR-199b-3p	CLIP-seq
MIRT2662798	hsa-miR-200a	CLIP-seq
MIRT2662799	hsa-miR-2052	CLIP-seq
MIRT2662800	hsa-miR-2053	CLIP-seq
MIRT2662801	hsa-miR-20a	CLIP-seq
MIRT2662802	hsa-miR-20b	CLIP-seq
MIRT2434735	hsa-miR-2110	CLIP-seq
MIRT2662803	hsa-miR-2113	CLIP-seq
MIRT2434737	hsa-miR-2355-3p	CLIP-seq
MIRT2434738	hsa-miR-26a	CLIP-seq
MIRT2434739	hsa-miR-26b	CLIP-seq
MIRT2434740	hsa-miR-298	CLIP-seq
MIRT2434741	hsa-miR-300	CLIP-seq
MIRT2434742	hsa-miR-3064-5p	CLIP-seq
MIRT2662804	hsa-miR-3117-5p	CLIP-seq
MIRT2434744	hsa-miR-3121-3p	CLIP-seq
MIRT2695263	hsa-miR-3124-3p	CLIP-seq
MIRT2662805	hsa-miR-3129-3p	CLIP-seq
MIRT2441689	hsa-miR-3129-5p	CLIP-seq
MIRT2662806	hsa-miR-3133	CLIP-seq
MIRT2434745	hsa-miR-3140-3p	CLIP-seq
MIRT2463544	hsa-miR-3144-5p	CLIP-seq
MIRT2695264	hsa-miR-3145-3p	CLIP-seq
MIRT2662808	hsa-miR-3148	CLIP-seq
MIRT2662809	hsa-miR-3149	CLIP-seq
MIRT2434747	hsa-miR-3156-5p	CLIP-seq
MIRT2434748	hsa-miR-3158-5p	CLIP-seq
MIRT2662810	hsa-miR-3159	CLIP-seq
MIRT2434749	hsa-miR-3160-5p	CLIP-seq
MIRT2662811	hsa-miR-3161	CLIP-seq
MIRT2434750	hsa-miR-3163	CLIP-seq
MIRT2434751	hsa-miR-3173-5p	CLIP-seq
MIRT2695265	hsa-miR-3184	CLIP-seq
MIRT2662812	hsa-miR-3190	CLIP-seq
MIRT2695266	hsa-miR-3191	CLIP-seq
MIRT2695267	hsa-miR-3192	CLIP-seq
MIRT2148800	hsa-miR-3198	CLIP-seq
MIRT2662813	hsa-miR-3200-3p	CLIP-seq
MIRT2662814	hsa-miR-3200-5p	CLIP-seq
MIRT2662815	hsa-miR-3202	CLIP-seq
MIRT2434753	hsa-miR-323-3p	CLIP-seq
MIRT2695268	hsa-miR-326	CLIP-seq
MIRT2695269	hsa-miR-330-5p	CLIP-seq
MIRT2662816	hsa-miR-33a	CLIP-seq
MIRT2662817	hsa-miR-33b	CLIP-seq
MIRT2434756	hsa-miR-34b	CLIP-seq
MIRT2434757	hsa-miR-3607-3p	CLIP-seq
MIRT2434758	hsa-miR-3609	CLIP-seq
MIRT2695270	hsa-miR-3613-3p	CLIP-seq
MIRT2434759	hsa-miR-3622b-5p	CLIP-seq
MIRT2434760	hsa-miR-3647-3p	CLIP-seq
MIRT2434761	hsa-miR-365	CLIP-seq
MIRT2434762	hsa-miR-3655	CLIP-seq
MIRT1493821	hsa-miR-3663-5p	CLIP-seq
MIRT2441690	hsa-miR-3664-3p	CLIP-seq
MIRT2148801	hsa-miR-3664-5p	CLIP-seq
MIRT2434763	hsa-miR-3667-3p	CLIP-seq
MIRT2434764	hsa-miR-3668	CLIP-seq
MIRT2434765	hsa-miR-3675-3p	CLIP-seq
MIRT2662818	hsa-miR-3677-5p	CLIP-seq
MIRT2662819	hsa-miR-3684	CLIP-seq
MIRT2695271	hsa-miR-3689a-5p	CLIP-seq
MIRT2695272	hsa-miR-3689b	CLIP-seq
MIRT2695273	hsa-miR-3689e	CLIP-seq
MIRT2695274	hsa-miR-3689f	CLIP-seq
MIRT2662820	hsa-miR-369-3p	CLIP-seq
MIRT2434767	hsa-miR-370	CLIP-seq
MIRT2662821	hsa-miR-374a	CLIP-seq
MIRT2662822	hsa-miR-374b	CLIP-seq
MIRT2434770	hsa-miR-381	CLIP-seq
MIRT2662823	hsa-miR-3915	CLIP-seq
MIRT2434771	hsa-miR-3919	CLIP-seq
MIRT2662824	hsa-miR-3920	CLIP-seq
MIRT2662825	hsa-miR-3928	CLIP-seq
MIRT2695275	hsa-miR-3936	CLIP-seq
MIRT2441691	hsa-miR-3941	CLIP-seq
MIRT2662826	hsa-miR-3977	CLIP-seq
MIRT2434772	hsa-miR-3978	CLIP-seq
MIRT2662827	hsa-miR-409-3p	CLIP-seq
MIRT2441692	hsa-miR-421	CLIP-seq
MIRT2695276	hsa-miR-423-5p	CLIP-seq
MIRT2434773	hsa-miR-424	CLIP-seq
MIRT2662828	hsa-miR-4251	CLIP-seq
MIRT2434774	hsa-miR-4263	CLIP-seq
MIRT2662829	hsa-miR-4265	CLIP-seq
MIRT2434777	hsa-miR-4271	CLIP-seq
MIRT2662830	hsa-miR-4275	CLIP-seq
MIRT2434778	hsa-miR-4290	CLIP-seq
MIRT2662831	hsa-miR-4296	CLIP-seq
MIRT2662832	hsa-miR-4297	CLIP-seq
MIRT2148803	hsa-miR-4303	CLIP-seq
MIRT2434779	hsa-miR-4305	CLIP-seq
MIRT2148804	hsa-miR-4309	CLIP-seq
MIRT2434780	hsa-miR-4310	CLIP-seq
MIRT2662833	hsa-miR-4311	CLIP-seq
MIRT2695277	hsa-miR-4314	CLIP-seq
MIRT2148805	hsa-miR-432	CLIP-seq
MIRT2662834	hsa-miR-4322	CLIP-seq
MIRT2695278	hsa-miR-433	CLIP-seq
MIRT2662835	hsa-miR-4417	CLIP-seq
MIRT2369208	hsa-miR-4420	CLIP-seq
MIRT1493824	hsa-miR-4422	CLIP-seq
MIRT2441693	hsa-miR-4433	CLIP-seq
MIRT2662836	hsa-miR-4445	CLIP-seq
MIRT2662837	hsa-miR-4446-5p	CLIP-seq
MIRT2441694	hsa-miR-4459	CLIP-seq
MIRT2662838	hsa-miR-4464	CLIP-seq
MIRT2434784	hsa-miR-4465	CLIP-seq
MIRT2662839	hsa-miR-4470	CLIP-seq
MIRT2662840	hsa-miR-4473	CLIP-seq
MIRT2434786	hsa-miR-4477a	CLIP-seq
MIRT2662841	hsa-miR-4492	CLIP-seq
MIRT2662842	hsa-miR-4498	CLIP-seq
MIRT2662843	hsa-miR-450b-5p	CLIP-seq
MIRT2695279	hsa-miR-4517	CLIP-seq
MIRT2441695	hsa-miR-4518	CLIP-seq
MIRT2369209	hsa-miR-452	CLIP-seq
MIRT2695280	hsa-miR-4520b-3p	CLIP-seq
MIRT2434791	hsa-miR-4524	CLIP-seq
MIRT2662845	hsa-miR-4527	CLIP-seq
MIRT2695281	hsa-miR-4528	CLIP-seq
MIRT2695282	hsa-miR-4529-3p	CLIP-seq
MIRT1493827	hsa-miR-455-5p	CLIP-seq
MIRT2662846	hsa-miR-4637	CLIP-seq
MIRT2662847	hsa-miR-4640-5p	CLIP-seq
MIRT2662848	hsa-miR-4642	CLIP-seq
MIRT2434792	hsa-miR-4646-5p	CLIP-seq
MIRT2695283	hsa-miR-4652-5p	CLIP-seq
MIRT2148807	hsa-miR-4653-3p	CLIP-seq
MIRT1493828	hsa-miR-4656	CLIP-seq
MIRT2695284	hsa-miR-4659a-3p	CLIP-seq
MIRT2695285	hsa-miR-4659b-3p	CLIP-seq
MIRT2441696	hsa-miR-466	CLIP-seq
MIRT2434793	hsa-miR-4666-3p	CLIP-seq
MIRT2434795	hsa-miR-4667-5p	CLIP-seq
MIRT2662849	hsa-miR-4671-3p	CLIP-seq
MIRT2441697	hsa-miR-4672	CLIP-seq
MIRT2662850	hsa-miR-4674	CLIP-seq
MIRT2662851	hsa-miR-4675	CLIP-seq
MIRT2369210	hsa-miR-4676-3p	CLIP-seq
MIRT2148809	hsa-miR-4682	CLIP-seq
MIRT2695286	hsa-miR-4691-5p	CLIP-seq
MIRT2148810	hsa-miR-4699-3p	CLIP-seq
MIRT2434798	hsa-miR-4700-5p	CLIP-seq
MIRT2441698	hsa-miR-4709-5p	CLIP-seq
MIRT2148811	hsa-miR-4714-5p	CLIP-seq
MIRT2434799	hsa-miR-4716-5p	CLIP-seq
MIRT2434800	hsa-miR-4724-3p	CLIP-seq
MIRT2434801	hsa-miR-4725-3p	CLIP-seq
MIRT2662852	hsa-miR-4726-5p	CLIP-seq
MIRT2695287	hsa-miR-4729	CLIP-seq
MIRT1493830	hsa-miR-4731-5p	CLIP-seq
MIRT2662853	hsa-miR-4738-3p	CLIP-seq
MIRT2662854	hsa-miR-4739	CLIP-seq
MIRT2662856	hsa-miR-4741	CLIP-seq
MIRT2434804	hsa-miR-4747-5p	CLIP-seq
MIRT2662857	hsa-miR-4748	CLIP-seq
MIRT2662858	hsa-miR-4752	CLIP-seq
MIRT2662859	hsa-miR-4756-5p	CLIP-seq
MIRT756276	hsa-miR-4757-3p	CLIP-seq
MIRT2434806	hsa-miR-4760-3p	CLIP-seq
MIRT2434807	hsa-miR-4764-5p	CLIP-seq
MIRT2662860	hsa-miR-4766-3p	CLIP-seq
MIRT2441699	hsa-miR-4768-3p	CLIP-seq
MIRT2369213	hsa-miR-4772-3p	CLIP-seq
MIRT2695288	hsa-miR-4775	CLIP-seq
MIRT2662861	hsa-miR-4778-3p	CLIP-seq
MIRT2662862	hsa-miR-4781-3p	CLIP-seq
MIRT2369214	hsa-miR-4790-3p	CLIP-seq
MIRT2662863	hsa-miR-4793-5p	CLIP-seq
MIRT2662864	hsa-miR-4795-3p	CLIP-seq
MIRT2662865	hsa-miR-4796-3p	CLIP-seq
MIRT2434809	hsa-miR-4796-5p	CLIP-seq
MIRT2434810	hsa-miR-4799-5p	CLIP-seq
MIRT2662866	hsa-miR-4800-3p	CLIP-seq
MIRT2662868	hsa-miR-487a	CLIP-seq
MIRT2695289	hsa-miR-491-3p	CLIP-seq
MIRT2441700	hsa-miR-494	CLIP-seq
MIRT2148812	hsa-miR-496	CLIP-seq
MIRT2434811	hsa-miR-497	CLIP-seq
MIRT2662869	hsa-miR-498	CLIP-seq
MIRT2434812	hsa-miR-503	CLIP-seq
MIRT2662870	hsa-miR-507	CLIP-seq
MIRT1493831	hsa-miR-512-3p	CLIP-seq
MIRT2695290	hsa-miR-513a-3p	CLIP-seq
MIRT2662871	hsa-miR-515-5p	CLIP-seq
MIRT2662872	hsa-miR-517a	CLIP-seq
MIRT2662873	hsa-miR-517c	CLIP-seq
MIRT2662874	hsa-miR-519d	CLIP-seq
MIRT2662875	hsa-miR-520f	CLIP-seq
MIRT2434816	hsa-miR-539	CLIP-seq
MIRT2434817	hsa-miR-544	CLIP-seq
MIRT2662876	hsa-miR-548a-3p	CLIP-seq
MIRT2662877	hsa-miR-548aa	CLIP-seq
MIRT2662878	hsa-miR-548ac	CLIP-seq
MIRT2662879	hsa-miR-548ae	CLIP-seq
MIRT2434819	hsa-miR-548ah	CLIP-seq
MIRT2662880	hsa-miR-548aj	CLIP-seq
MIRT2662881	hsa-miR-548am	CLIP-seq
MIRT2662882	hsa-miR-548c-3p	CLIP-seq
MIRT2662883	hsa-miR-548d-3p	CLIP-seq
MIRT2662884	hsa-miR-548e	CLIP-seq
MIRT2662885	hsa-miR-548f	CLIP-seq
MIRT2434821	hsa-miR-548g	CLIP-seq
MIRT2662886	hsa-miR-548k	CLIP-seq
MIRT2434822	hsa-miR-548n	CLIP-seq
MIRT2662887	hsa-miR-548p	CLIP-seq
MIRT2434823	hsa-miR-548t	CLIP-seq
MIRT2662888	hsa-miR-548x	CLIP-seq
MIRT2662889	hsa-miR-548z	CLIP-seq
MIRT2662890	hsa-miR-550a	CLIP-seq
MIRT2695291	hsa-miR-556-5p	CLIP-seq
MIRT2662891	hsa-miR-557	CLIP-seq
MIRT2662892	hsa-miR-561	CLIP-seq
MIRT2662893	hsa-miR-564	CLIP-seq
MIRT2662894	hsa-miR-568	CLIP-seq
MIRT2434825	hsa-miR-576-3p	CLIP-seq
MIRT2434826	hsa-miR-576-5p	CLIP-seq
MIRT2441701	hsa-miR-577	CLIP-seq
MIRT2695292	hsa-miR-579	CLIP-seq
MIRT2662895	hsa-miR-580	CLIP-seq
MIRT2662896	hsa-miR-583	CLIP-seq
MIRT2662897	hsa-miR-586	CLIP-seq
MIRT2434827	hsa-miR-587	CLIP-seq
MIRT2662898	hsa-miR-589	CLIP-seq
MIRT2662899	hsa-miR-595	CLIP-seq
MIRT2662900	hsa-miR-599	CLIP-seq
MIRT2434828	hsa-miR-604	CLIP-seq
MIRT2434829	hsa-miR-606	CLIP-seq
MIRT2695293	hsa-miR-610	CLIP-seq
MIRT2434831	hsa-miR-616	CLIP-seq
MIRT2434832	hsa-miR-621	CLIP-seq
MIRT2662901	hsa-miR-624	CLIP-seq
MIRT2148813	hsa-miR-628-5p	CLIP-seq
MIRT2434833	hsa-miR-629	CLIP-seq
MIRT2662902	hsa-miR-635	CLIP-seq
MIRT2695294	hsa-miR-637	CLIP-seq
MIRT2434835	hsa-miR-646	CLIP-seq
MIRT2434836	hsa-miR-647	CLIP-seq
MIRT2662903	hsa-miR-649	CLIP-seq
MIRT2434837	hsa-miR-660	CLIP-seq
MIRT2434838	hsa-miR-676	CLIP-seq
MIRT2148814	hsa-miR-759	CLIP-seq
MIRT2662904	hsa-miR-762	CLIP-seq
MIRT2434839	hsa-miR-767-5p	CLIP-seq
MIRT2369218	hsa-miR-891b	CLIP-seq
MIRT2434840	hsa-miR-892b	CLIP-seq
MIRT2662905	hsa-miR-93	CLIP-seq
MIRT2441702	hsa-miR-936	CLIP-seq
MIRT2695295	hsa-miR-942	CLIP-seq
MIRT2662906	hsa-miR-96	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CUX1	Activation	17227781;23359789
HOXB7	Activation	21183939
PITX2	Unknown	23250740

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001736	Process	Establishment of planar polarity	IEA
GO:0001756	Process	Somitogenesis	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001822	Process	Kidney development	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IEP	12841867
GO:0001843	Process	Neural tube closure	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	17986384
GO:0001947	Process	Heart looping	IEA
GO:0002009	Process	Morphogenesis of an epithelium	IEA
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	IEA
GO:0002088	Process	Lens development in camera-type eye	ISS	16258938
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	IMP	18174455
GO:0003138	Process	Primary heart field specification	IEA
GO:0003139	Process	Secondary heart field specification	IEA
GO:0003281	Process	Ventricular septum development	IEA
GO:0003283	Process	Atrial septum development	IEA
GO:0003323	Process	Type B pancreatic cell development	IEA
GO:0003344	Process	Pericardium morphogenesis	IEA
GO:0003401	Process	Axis elongation	IEA
GO:0003408	Process	Optic cup formation involved in camera-type eye development	ISS	16258938
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005109	Function	Frizzled binding	IBA
GO:0005109	Function	Frizzled binding	IEA
GO:0005109	Function	Frizzled binding	IPI	18174455
GO:0005109	Function	Frizzled binding	TAS	25424568
GO:0005115	Function	Receptor tyrosine kinase-like orphan receptor binding	IPI	18287027
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	22784633, 26342861, 33961781, 34731008, 36994853
GO:0005543	Function	Phospholipid binding	TAS	25424568
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	25424568
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	18703641, 19048125, 20034610
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IMP	31512787
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IMP	19099253
GO:0007223	Process	Wnt signaling pathway, calcium modulating pathway	IEA
GO:0007223	Process	Wnt signaling pathway, calcium modulating pathway	IMP	17986384
GO:0007223	Process	Wnt signaling pathway, calcium modulating pathway	NAS	24431302
GO:0007254	Process	JNK cascade	IEA
GO:0007368	Process	Determination of left/right symmetry	IEA
GO:0007409	Process	Axonogenesis	IEA
GO:0007411	Process	Axon guidance	IEA
GO:0007411	Process	Axon guidance	ISS
GO:0007442	Process	Hindgut morphogenesis	IEA
GO:0007494	Process	Midgut development	IEA
GO:0008104	Process	Intracellular protein localization	IDA	19177143
GO:0008104	Process	Intracellular protein localization	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0008584	Process	Male gonad development	IEP	17848411
GO:0008595	Process	Anterior/posterior axis specification, embryo	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010463	Process	Mesenchymal cell proliferation	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	17035633, 17986384
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010631	Process	Epithelial cell migration	IEA
GO:0010742	Process	Macrophage derived foam cell differentiation	IMP	31512787
GO:0010820	Process	Positive regulation of T cell chemotaxis	IMP	19520808
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0016055	Process	Wnt signaling pathway	IDA	20034610
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016477	Process	Cell migration	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0021891	Process	Olfactory bulb interneuron development	IEA
GO:0021891	Process	Olfactory bulb interneuron development	ISS
GO:0021915	Process	Neural tube development	IEA
GO:0022008	Process	Neurogenesis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	ISS
GO:0030216	Process	Keratinocyte differentiation	IEP	19399181
GO:0030324	Process	Lung development	IEA
GO:0030326	Process	Embryonic limb morphogenesis	IEA
GO:0030509	Process	BMP signaling pathway	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0030901	Process	Midbrain development	IEA
GO:0031012	Component	Extracellular matrix	HDA	28327460
GO:0031012	Component	Extracellular matrix	IEA
GO:0032722	Process	Positive regulation of chemokine production	IMP	19520808
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IMP	18174455
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	18174455
GO:0032757	Process	Positive regulation of interleukin-8 production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0032880	Process	Regulation of protein localization	IEA
GO:0035022	Process	Positive regulation of Rac protein signal transduction	IEA
GO:0035108	Process	Limb morphogenesis	IEA
GO:0035567	Process	Non-canonical Wnt signaling pathway	IEA
GO:0035567	Process	Non-canonical Wnt signaling pathway	TAS	24449494
GO:0036342	Process	Post-anal tail morphogenesis	IEA
GO:0036517	Process	Chemoattraction of serotonergic neuron axon	IEA
GO:0036517	Process	Chemoattraction of serotonergic neuron axon	ISS
GO:0036518	Process	Chemorepulsion of dopaminergic neuron axon	IEA
GO:0036518	Process	Chemorepulsion of dopaminergic neuron axon	ISS
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	IEA
GO:0042060	Process	Wound healing	IDA	19878652
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0042733	Process	Embryonic digit morphogenesis	IEA
GO:0043032	Process	Positive regulation of macrophage activation	IMP	18174455
GO:0043066	Process	Negative regulation of apoptotic process	IDA	19251946
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IEA
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	20032469
GO:0045165	Process	Cell fate commitment	IBA
GO:0045198	Process	Establishment of epithelial cell apical/basal polarity	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IMP	20032469
GO:0045732	Process	Positive regulation of protein catabolic process	IGI	12952940
GO:0045766	Process	Positive regulation of angiogenesis	IMP	17035633
GO:0045778	Process	Positive regulation of ossification	IMP	20032469
GO:0045807	Process	Positive regulation of endocytosis	IEA
GO:0045836	Process	Positive regulation of meiotic nuclear division	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	19277043
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	19847889
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	18174455
GO:0046330	Process	Positive regulation of JNK cascade	IDA	20034610
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046546	Process	Development of primary male sexual characteristics	IEA
GO:0048018	Function	Receptor ligand activity	IC	18174455
GO:0048022	Process	Negative regulation of melanin biosynthetic process	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	19251946
GO:0048341	Process	Paraxial mesoderm formation	IEA
GO:0048546	Process	Digestive tract morphogenesis	IEA
GO:0048570	Process	Notochord morphogenesis	IEA
GO:0048706	Process	Embryonic skeletal system development	IMP	19918918
GO:0048806	Process	Genitalia development	IMP	19918918
GO:0048812	Process	Neuron projection morphogenesis	IEA
GO:0048843	Process	Negative regulation of axon extension involved in axon guidance	IEA
GO:0048846	Process	Axon extension involved in axon guidance	IEA
GO:0048850	Process	Hypophysis morphogenesis	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0050727	Process	Regulation of inflammatory response	NAS	21857966
GO:0050729	Process	Positive regulation of inflammatory response	IMP	18174455
GO:0050807	Process	Regulation of synapse organization	IDA	18986540
GO:0050807	Process	Regulation of synapse organization	IMP	18986540
GO:0050919	Process	Negative chemotaxis	IEA
GO:0051216	Process	Cartilage development	IEA
GO:0051885	Process	Positive regulation of timing of anagen	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	20034610
GO:0051964	Process	Negative regulation of synapse assembly	IEA
GO:0060026	Process	Convergent extension	IEA
GO:0060028	Process	Convergent extension involved in axis elongation	IEA
GO:0060029	Process	Convergent extension involved in organogenesis	IEA
GO:0060065	Process	Uterus development	IEA
GO:0060067	Process	Cervix development	IEA
GO:0060068	Process	Vagina development	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	IEA
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	ISS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS	22988876, 23517308, 24431302
GO:0060157	Process	Urinary bladder development	IEA
GO:0060324	Process	Face development	IMP	19918918
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IDA	19399181
GO:0060599	Process	Lateral sprouting involved in mammary gland duct morphogenesis	IEA
GO:0060606	Process	Tube closure	IEA
GO:0060638	Process	Mesenchymal-epithelial cell signaling	IEA
GO:0060686	Process	Negative regulation of prostatic bud formation	IEA
GO:0060744	Process	Mammary gland branching involved in thelarche	IEA
GO:0060750	Process	Epithelial cell proliferation involved in mammary gland duct elongation	IEA
GO:0060760	Process	Positive regulation of response to cytokine stimulus	IDA	19399181
GO:0060762	Process	Regulation of branching involved in mammary gland duct morphogenesis	IEA
GO:0060809	Process	Mesodermal to mesenchymal transition involved in gastrulation	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	IMP	18174455
GO:0061036	Process	Positive regulation of cartilage development	IEA
GO:0061053	Process	Somite development	IEA
GO:0062009	Process	Secondary palate development	IMP	18413325
GO:0070062	Component	Extracellular exosome	TAS
GO:0070242	Process	Thymocyte apoptotic process	IEA
GO:0070245	Process	Positive regulation of thymocyte apoptotic process	IEA
GO:0071219	Process	Cellular response to molecule of bacterial origin	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEP	18174455
GO:0071277	Process	Cellular response to calcium ion	IEP	18703641
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:0071346	Process	Cellular response to type II interferon	IEP	18174455
GO:0071425	Process	Hematopoietic stem cell proliferation	IDA	9787155
GO:0071425	Process	Hematopoietic stem cell proliferation	IEA
GO:0071542	Process	Dopaminergic neuron differentiation	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEP	15040835
GO:0072089	Process	Stem cell proliferation	IEA
GO:0072201	Process	Negative regulation of mesenchymal cell proliferation	IDA	19878652
GO:0090009	Process	Primitive streak formation	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IGI	12952940
GO:0090103	Process	Cochlea morphogenesis	IEA
GO:0097325	Process	Melanocyte proliferation	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IDA	18986540, 27402827
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IMP	18986540, 27402827
GO:0099054	Process	Presynapse assembly	TAS	24449494
GO:0099068	Process	Postsynapse assembly	TAS	24449494
GO:0099170	Process	Postsynaptic modulation of chemical synaptic transmission	IEA
GO:0099175	Process	Regulation of postsynapse organization	IDA	27402827
GO:0099175	Process	Regulation of postsynapse organization	IMP	27402827
GO:0099566	Process	Regulation of postsynaptic cytosolic calcium ion concentration	IDA	27402827
GO:0099566	Process	Regulation of postsynaptic cytosolic calcium ion concentration	IMP	27402827
GO:0140013	Process	Meiotic nuclear division	IEA
GO:0150012	Process	Positive regulation of neuron projection arborization	IEA
GO:0150012	Process	Positive regulation of neuron projection arborization	ISS
GO:1900020	Process	Positive regulation of protein kinase C activity	IMP	12086864
GO:1902035	Process	Positive regulation of hematopoietic stem cell proliferation	IEA
GO:1902379	Function	Chemoattractant activity involved in axon guidance	IEA
GO:1902474	Process	Positive regulation of protein localization to synapse	TAS	24449494
GO:1904861	Process	Excitatory synapse assembly	TAS	24449494
GO:1904862	Process	Inhibitory synapse assembly	TAS	24449494
GO:1904934	Process	Negative regulation of cell proliferation in midbrain	IEA
GO:1904934	Process	Negative regulation of cell proliferation in midbrain	NAS	24431302
GO:1904948	Process	Midbrain dopaminergic neuron differentiation	IEA
GO:1904948	Process	Midbrain dopaminergic neuron differentiation	TAS	22988876
GO:2000049	Process	Positive regulation of cell-cell adhesion mediated by cadherin	IEA
GO:2000052	Process	Positive regulation of non-canonical Wnt signaling pathway	IEA
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	ISS

Other IDs

• MIM: 164975
• HGNC: 12784
• e!Ensembl: ENSG00000114251

Protein

• UniProt ID: P41221
• Protein name: Protein Wnt-5a
• Protein function: Ligand for members of the frizzled family of seven transmembrane receptors. Can activate or inhibit canonical Wnt signaling, depending on receptor context. In the presence of FZD4, activates beta-catenin signaling. In the presence of ROR2, inhib
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00110	wnt	71 → 380	wnt family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expression is increased in differentiated thyroid carcinomas compared to normal thyroid tissue and anaplastic thyroid tumors where expression is low or undetectable. Expression is found in thyrocytes but not in stromal cells (at protei
• Sequence:

  MKKSIGILSPGVALGMAGSAMSSKFFLVALAIFFSFAQVVIEANSWWSLGMNNPVQMSEV
  YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
  TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
  GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
  HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
  YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
  WCCYVKCKKCTEIVDQFVCK

• Sequence length: 380

Pathways

KEGG:

mTOR signaling pathway
Wnt signaling pathway
Axon guidance
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Cushing syndrome
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Human papillomavirus infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Reactome:

TCF dependent signaling in response to WNT
WNT ligand biogenesis and trafficking
Ca2+ pathway
PCP/CE pathway
Asymmetric localization of PCP proteins
WNT5A-dependent internalization of FZD4
WNT5A-dependent internalization of FZD2, FZD5 and ROR2
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
WNT5:FZD7-mediated leishmania damping

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autosomal dominant Robinow syndrome 1	Pathogenic; Likely pathogenic	rs786204837, rs786204836, rs387906663, rs786200925, rs1553677971, rs2106946273	RCV001376107 RCV000169740 RCV000022695 RCV000022696 RCV000577882 RCV001353076 RCV001353077	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTOSOMAL DOMINANT ROBINOW SYNDROME	—	ClinGen, Disgenet, Orphanet ClinGen, Disgenet, Orphanet ClinGen, Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FEMALE UROGENITAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ROBINOW SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ROBINOW SYNDROME, AUTOSOMAL DOMINANT 1	—	Disgenet, HPO Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Short stature	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE CERVICAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VESICOURETERAL REFLUX	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WNT5A-related disorder	Likely benign; Conflicting classifications of pathogenicity; Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Accessory kidney	Accessory Kidney	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	28440495		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	17614820, 18032022, 30631148		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	21816908		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	16314637, 17227781, 24999479, 28465645		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18703641		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	24156409, 24395444		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	27245242		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	29336472		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	27270428		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	23278988		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	23660959		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	30324689, 31593304		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	23826406, 30924074		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	30924074	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31557131		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	36959563	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18456733, 20554957, 24346141, 27859213, 29474941, 29674475, 31512787, 31678514		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28724439, 30213634		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	35055107	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10688908, 11315916, 33178184, 34211463	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	31313518		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	27297409, 33303529	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	18456733, 20554957, 24346141, 27859213, 29474941, 29674475, 31512787, 31678514		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24346141, 33818249, 35282771	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29104639		★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	25204426		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28724439		★☆☆☆☆ Found in Text Mining only
Autosomal dominant Robinow syndrome	Robinow Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Avascular necrosis of the capital femoral epiphysis	Avascular Necrosis Of The Capital Femoral Epiphysis	HPO_DG			★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	18549404		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	14667502, 26409451, 29201214		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	30841855		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	21270611		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	19061910, 30032142		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	29704505		★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	28851822		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	20465808	Associate	★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	12049819		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	29110584	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11809689, 15868903, 16914445, 22547701, 22655072, 22939885, 23353182, 23417837, 23484019, 23679576, 26970271, 27500936, 27623766, 28005837, 29069720, 29207169, 29765514, 31114334, 9716023, 9815976		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15868903, 16330545, 16569699, 16880514, 16914445, 19244247, 21871017, 22547701, 23990917, 24260410, 24293407, 25204426, 27500936, 29207169, 34047951, 36476423, 37029329, 9367869	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22655072, 23679576	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22939885, 23417837, 27623766	Inhibit	★☆☆☆☆ Found in Text Mining only
Brooke-Spiegler syndrome	Brooke-Spiegler Syndrome	BEFREE	28118819		★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	37427430	Associate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	24518599	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22293903, 22966878, 23349696, 24351810, 24416340, 24865425, 31198984, 35595735, 36476423	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29487190	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	24156409		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	11348463, 22384081	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	19874621	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18477650, 18577996, 19849855, 22493546, 25031739, 37814183	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	19061910, 30032142, 9461004		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19351856, 23349696, 28340578, 30901718		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24351810, 24785108, 30079293	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31557131, 34565024, 37914721	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33804101, 37173306, 9679734	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	12841867, 23505429, 36867945	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22384081, 24999479, 28340578, 35850748	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	20233865		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21270611, 21816908, 24606488, 24785108, 26515598, 28536612, 28538104, 28560060, 30079293		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	28615692		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	28615692		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	22485170	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31678514		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	28587781	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Hypoplasia	Cerebellar Hypoplasia	BEFREE	28205531		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	35622188	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29510185		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	CTD_human_DG	25061499		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25337253		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25337253		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	23278988		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24549785	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26690702, 27815263, 27904138, 28465528, 28465529, 29678828, 29872501, 31409670, 31645416		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30090106, 30268495		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	22485170	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	23459936		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	23459936	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	31172578	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	31262291	Associate	★☆☆☆☆ Found in Text Mining only
Clinodactyly	Clinodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	38303405	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12147710, 21115903, 22522911, 23764752, 24464650, 28748258		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	19063862		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	27245242, 36704936	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18172252, 21587258, 22966878, 23764752, 24564183, 24833087, 25619716, 27522468, 28051879, 28600110, 28859077, 29160937		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12147710, 17463182, 21587258, 22522911, 22966878, 24504536, 24564183, 25107489, 28859077, 29160937, 29453334, 29869456, 33034614, 33125346, 33300054, 37998393, 38224823, 39385172	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24260410, 24833087	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32258125	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital euryblepharon	Congenital Euryblepharon	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital exomphalos	Congenital Exomphalos	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of penis	Congenital Hypoplasia Of Penis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital malformation syndrome	Congenital Malformation Syndrome	BEFREE	29575631		★☆☆☆☆ Found in Text Mining only
Congenital pectus carinatum	Congenital Pectus Carinatum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28357477, 31170826		★☆☆☆☆ Found in Text Mining only
Conotruncal cardiac defects	Conotruncal cardiac defect	Pubtator	26278011	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	31534019		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	31534019		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	31981630	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	36603481	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	31534019		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10688908, 28587781, 28647646, 28777797, 29164146, 30257711, 30544699		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	33967051	Associate	★☆☆☆☆ Found in Text Mining only
Developmental absence of tooth	Anodontia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27859213		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26800561, 37460827	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27859213		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35436882	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29674475, 30025875		★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	31902091	Associate	★☆☆☆☆ Found in Text Mining only
Double ureter	Double Ureter	BEFREE	26794322		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	19011014	Associate	★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane Retraction Syndrome	BEFREE	25817016		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	11809689		★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	20676061	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31198984		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	31198984, 9099960	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37335710	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	24661731	Stimulate	★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia verruciformis	Pubtator	37427430	Associate	★☆☆☆☆ Found in Text Mining only
Epispadias	Epispadias	HPO_DG			★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21270611, 21816908, 24785108, 30079293		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33793074	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	20603606	Inhibit	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35595735	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	23075330		★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	30840655		★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Familial Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	28726637		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	29377497		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	29377497		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	36077270	Associate	★☆☆☆☆ Found in Text Mining only
Female Urogenital Diseases	Female Urogenital Diseases	CTD_human_DG	16002989		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fingernail dysplasia	Fingernail dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Frontal bossing	Frontal bossing	HPO_DG			★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	26624524		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	24726140	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17709179, 23748645, 25301448, 25772239, 27013470, 27863244, 28011620, 29207169, 29531296, 30784283, 31114334		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27863244, 29110584, 29207169, 33857857, 36314076	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17709179, 23748645, 25301448, 25772239, 27013470, 27863244, 28011620, 29207169, 29531296, 30784283, 31114334		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17709179, 21990322, 26511503, 27739438, 29531296, 30322948		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	17709179		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	21205070, 27863244, 33161527, 34657400, 36314076	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32181818	Stimulate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	16601243	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	22554965	Associate	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	20465808	Associate	★☆☆☆☆ Found in Text Mining only
Hamman-Rich Disease	Diffuse interstitial pulmonary fibrosis	CTD_human_DG	28726637		★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	26278011	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	28411232	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28357477, 31170826		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	24260410, 34334378	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	29371911		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	14667502		★☆☆☆☆ Found in Text Mining only
Hemoglobin SC Disease	Hemoglobin sc disease	Pubtator	28465645	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	38062395	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	38062395	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	34047951	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	20603606	Inhibit	★☆☆☆☆ Found in Text Mining only
Hernia, Femoral	Hernia, Femoral	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	27270428		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	27923152		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperalgesia	Hyperalgesia	Pubtator	35040478	Associate	★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	23660959		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	16470182	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27882931, 30085132		★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16914445	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36314076	Stimulate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	30816547		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	26787464, 30586764		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19251946, 26538547, 31072629		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	26538547, 26997628, 37545510	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	28726637		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Impaired cognition	Impaired Cognition	BEFREE	27878554		★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	30899591		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	26800561, 29229927	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	27688298	Stimulate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	29656141		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	29656141, 33090383	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	23764752		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	37819756	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	23764752		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	30172652		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	30994860		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	28781662		★☆☆☆☆ Found in Text Mining only
Legg-Calve-Perthes Disease	Legg-Calve-Perthes Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
LEPTIN DEFICIENCY OR DYSFUNCTION	LEPTIN DEFICIENCY OR DYSFUNCTION	BEFREE	25362254		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	14667502, 21165581, 29678828		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	28923920	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19874313, 28440495	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25428027	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19874313, 28440495, 31325181		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18294932, 19849855, 22493546, 24696716, 28754618, 29709351, 31136984, 31436250, 31700026		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18477650		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	30871618	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	25413872		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	38062395	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	19251946, 31072629		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	23349696		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	23349696	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25337253	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26721633	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30079293, 33654199, 35595735	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	26608372	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	27270428		★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Macroglossia	Macroglossia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	26246285	Associate	★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	29872501		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15868903, 16914445, 19244247, 22547701, 22655072, 22939885, 23353182, 23417837, 23484019, 23679576, 26970271, 27500936, 27623766, 28005837, 29069720, 29207169, 29765514, 31114334, 9716023, 9815976		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31198984		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19351856, 23349696, 28340578, 30901718		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	23349696		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21270611, 24606488, 26515598, 28536612, 28538104, 28560060		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17227781, 18298655, 19470740, 23359789, 24156409, 24395444, 25308364		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20101234, 20454608, 21802500, 24064566, 24464650, 24972966, 26383955, 28030815, 28886116, 29381686, 29930766, 30593464, 31409900, 31762801		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11956659, 16273260, 19582886, 22101459, 23123500, 24681952, 24993819, 28135710, 30579603, 31171711		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	19061910, 30032142, 9461004		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12147710, 15363539, 16273260, 19470740, 21270611, 22547701, 23123500, 23615002, 23679576, 23764752, 24064566, 24395444, 24993819, 25337253, 25823923, 26055321, 26690702, 26721633, 27859213, 28011620, 28157427, 28491097, 28886116, 29098008, 29648538, 29765514, 29853734, 29859176, 30899591, 31085554, 31198984, 31510045, 31557131, 9716023		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25337253		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12147710, 21115903, 22522911, 23764752, 24464650, 28748258, 30952711		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16880514, 19237581		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16914445, 24586797, 27500936, 29069720		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	29872501		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	23278988		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	23278988	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12086864, 16116595, 16273260, 17379691, 17426020, 19074888, 19470740, 19802008, 20955350, 24464650, 24766647, 24865425, 26055321, 26357060, 26934938, 26970271, 28887323, 29648538, 29993697, 31510045		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12086864, 17992121, 18794093, 19074888		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	12086864, 14514922, 16116595, 17426020, 19099253, 19177143, 19696445, 19946729, 21494614, 23462101, 24293407, 24587766, 24766647, 24865425, 25944911, 26055321, 27191257, 29648538, 30582770, 33969605, 36539575	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24260410, 24954857	Stimulate	★☆☆☆☆ Found in Text Mining only
Mesomelia	Mesomelia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	26800561, 28411232, 29229927	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	31981630	Inhibit	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	19074888, 29370526		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	29381686, 31762801		★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Micromelia	Micromelia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	7759542	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	33167868	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	20465808, 40650009	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22781592		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	14667502		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	29704505		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	28357477		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	27554815		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	24626628, 25066400, 25823923, 29535816, 31319350		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25066400	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12086864, 14667502, 15868903, 16314637, 17227781, 17709179, 18032022, 18172252, 18294932, 18549404, 19048125, 19074888, 19470740, 19561643, 19874313, 20233865, 20603606, 21494614, 21587258, 21816908, 22493546, 23001722, 23349696, 23359789, 23417837, 23615002, 23947922, 24158497, 24395444, 24464650, 24564183, 24696716, 24766647, 24833087, 24865425, 25107489, 25619716, 26054690, 26608372, 27500936, 27522468, 28051879, 28135710, 28232477, 28536612, 28859077, 28886116, 29054966, 29061504, 29113233, 29345412, 29370526, 30085132, 30405404, 30643192, 31198984, 31436250, 9461004		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	19048125		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19815336		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	24260410	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	34079083	Inhibit	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16314637, 20664938, 23349696, 24999479, 26305508, 29054966, 29415994		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22384249, 24840810, 28272483, 28411232, 28851071, 31534019		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22384249, 27688298, 28272483, 28411232	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	39837875	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	36077270	Inhibit	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 1B	Oculocutaneous albinism	Pubtator	25913759	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29765514		★☆☆☆☆ Found in Text Mining only
Oligodontia	Oligodontia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10688908	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	22485170, 28587781, 28777797	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	27556044	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28095260		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28851822, 30007964, 31210281		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22293903, 26978652, 40616392	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26054690, 26708300, 26978652, 28240050, 28289332, 29213214, 29345412		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	24351810	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	21270611, 24606488, 26515598, 28536612, 28538104, 28560060		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24351810, 24606488, 24785108, 28536612, 30079293, 33723319, 35053353	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17227781, 18298655, 19470740, 23359789, 24156409, 24395444, 25308364		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	17227781		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18298655, 24156409, 33200805	Associate	★☆☆☆☆ Found in Text Mining only
Papillary craniopharyngioma	Papillary Craniopharyngioma	BEFREE	28427201, 29229927		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	17525119, 29113233, 31496749		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	18060047		★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	31831777		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical periodontitis	Pubtator	31831777	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	28851822, 30324689		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	22485170, 27602578, 28095260		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	27602578	Associate	★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	21341271		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	26624524		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	31655798	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Recessive	Polycystic kidney disease	Pubtator	30414501	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	25303486		★☆☆☆☆ Found in Text Mining only
Port-Wine Stain	Phakomatosis pigmentovascularis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Posteriorly rotated ear	Posteriorly Rotated Ear	HPO_DG			★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	30631148		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20101234, 20454608, 21802500, 24064566, 24464650, 24972966, 26383955, 28030815, 28886116, 29381686, 29930766, 30593464, 31409900, 31762801		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15067324, 18632632		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20454608, 22039506, 23342259, 35930737, 36623397	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20603606, 24518599, 24972966, 28030815, 29453313, 31409900, 33639039, 34889941, 35131873	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	31719098		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	19399181, 25219536, 26202350, 29286164		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	20376066, 22384081, 38303405	Associate	★☆☆☆☆ Found in Text Mining only
Psychomotor Agitation	Psychiatric disorders	Pubtator	33967051	Associate	★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30586764		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	27036869	Associate	★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30333225		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	35484165	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Degeneration	Retinal degeneration	Pubtator	35622188	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28469167		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	35796028	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	35796028	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10688908, 20554957, 28151034, 28724439, 29755657, 31072629		★☆☆☆☆ Found in Text Mining only
Robinow Syndrome	Robinow Syndrome	BEFREE	19918918, 23850867, 24932600, 28662348, 29575631		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Robinow Syndrome	Robinow Syndrome	CLINVAR_DG	19918918, 24716670		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Robinow Syndrome	Robinow Syndrome	ORPHANET_DG	19918918		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Robinow Syndrome	Robinow syndrome	Pubtator	25817016	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Robinow Syndrome	Robinow Syndrome	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Robinow Syndrome, Autosomal Dominant	Robinow Syndrome	BEFREE	19918918, 24716670, 25817016		★☆☆☆☆ Found in Text Mining only
Robinow Syndrome, Autosomal Dominant	Robinow Syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
ROBINOW SYNDROME, AUTOSOMAL DOMINANT 1	Robinow Syndrome	UNIPROT_DG	19918918		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ROBINOW SYNDROME, AUTOSOMAL DOMINANT 1	Robinow Syndrome	GENOMICS_ENGLAND_DG	19918918		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ROBINOW SYNDROME, AUTOSOMAL DOMINANT 1	Robinow Syndrome	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	Pubtator	21146388	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	23075330, 26739507	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	32143829	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
SEBASTIAN SYNDROME	SEBASTIAN SYNDROME	BEFREE	28118819		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	22547701, 35239776	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	23679576	Stimulate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	18174455, 19361356, 22547701, 27859213, 28529460, 28717346		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	22384081	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	22384081	Associate	★☆☆☆☆ Found in Text Mining only
Specific learning disability	Specific Learning Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	23417837		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12841867		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16314637, 23505429, 27876017, 28340578		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	20603606, 31114334		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19543744, 28157427, 28559016, 28603941, 31902091, 33840648	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	27876017		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	28559016, 29134466		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	30816547		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11956659, 16273260, 19582886, 22101459, 23123500, 23615002, 24681952, 24993819, 28135710, 30405404, 30579603, 31171711		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	11956659		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	19582886		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24260410	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24351810, 24416340, 25779663, 26708384, 26939869, 28560594, 30624523, 30829316, 33654199, 38240752	Associate	★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	35622188	Associate	★☆☆☆☆ Found in Text Mining only
Syndactyly	Syndactyly	BEFREE	29292497		★☆☆☆☆ Found in Text Mining only
Syndactyly of fingers	Syndactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	17525119		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26721633, 29249801		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26721633	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	19061910, 28193625, 30032142, 31268162	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	23947922, 28427201		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	CTD_human_DG	25061499		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25337253	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	38555994	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular Diseases	Vascular disease	Pubtator	26800561	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	31534019		★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	23095888, 29575631		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	37815464	Associate	★☆☆☆☆ Found in Text Mining only
Zimmerman Laband syndrome	Zimmerman Laband Syndrome	BEFREE	17163523, 17937436		★☆☆☆☆ Found in Text Mining only