Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	747
Gene name	Diacylglycerol lipase alpha
Gene symbol	DAGLA
Synonyms (NCBI Gene)	C11orf11DAGL(ALPHA)DAGLALPHANOC2NSDDR
Chromosome	11
Chromosome location	11q12.2
Summary	This gene encodes a diacylglycerol lipase. The encoded enzyme is involved in the biosynthesis of the endocannabinoid 2-arachidonoyl-glycerol.[provided by RefSeq, Nov 2010]

208

Show/Hide all (208)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018137	hsa-miR-335-5p	Microarray	18185580
MIRT440850	hsa-miR-127-3p	HITS-CLIP	24374217
MIRT440850	hsa-miR-127-3p	HITS-CLIP	24374217
MIRT922807	hsa-miR-1185	CLIP-seq
MIRT922808	hsa-miR-1207-5p	CLIP-seq
MIRT922809	hsa-miR-1262	CLIP-seq
MIRT922810	hsa-miR-127-5p	CLIP-seq
MIRT922811	hsa-miR-1293	CLIP-seq
MIRT922812	hsa-miR-145	CLIP-seq
MIRT922813	hsa-miR-1587	CLIP-seq
MIRT922814	hsa-miR-183	CLIP-seq
MIRT922815	hsa-miR-1908	CLIP-seq
MIRT922816	hsa-miR-214	CLIP-seq
MIRT922817	hsa-miR-2278	CLIP-seq
MIRT922818	hsa-miR-2682	CLIP-seq
MIRT922819	hsa-miR-3120-3p	CLIP-seq
MIRT922820	hsa-miR-3150a-3p	CLIP-seq
MIRT922821	hsa-miR-3175	CLIP-seq
MIRT922822	hsa-miR-3182	CLIP-seq
MIRT922823	hsa-miR-3189-3p	CLIP-seq
MIRT922824	hsa-miR-34a	CLIP-seq
MIRT922825	hsa-miR-34c-5p	CLIP-seq
MIRT922826	hsa-miR-3605-5p	CLIP-seq
MIRT922827	hsa-miR-3619-5p	CLIP-seq
MIRT922828	hsa-miR-362-5p	CLIP-seq
MIRT922829	hsa-miR-3679-5p	CLIP-seq
MIRT922830	hsa-miR-378g	CLIP-seq
MIRT922831	hsa-miR-3942-5p	CLIP-seq
MIRT922832	hsa-miR-3977	CLIP-seq
MIRT922833	hsa-miR-4252	CLIP-seq
MIRT922834	hsa-miR-431	CLIP-seq
MIRT922835	hsa-miR-4327	CLIP-seq
MIRT922836	hsa-miR-4436b-3p	CLIP-seq
MIRT922837	hsa-miR-4483	CLIP-seq
MIRT922838	hsa-miR-4492	CLIP-seq
MIRT922839	hsa-miR-4498	CLIP-seq
MIRT922840	hsa-miR-449a	CLIP-seq
MIRT922841	hsa-miR-449b	CLIP-seq
MIRT922842	hsa-miR-449c	CLIP-seq
MIRT922843	hsa-miR-4514	CLIP-seq
MIRT922844	hsa-miR-4530	CLIP-seq
MIRT922845	hsa-miR-4633-5p	CLIP-seq
MIRT922846	hsa-miR-4643	CLIP-seq
MIRT922847	hsa-miR-4656	CLIP-seq
MIRT922848	hsa-miR-4661-3p	CLIP-seq
MIRT922849	hsa-miR-4667-5p	CLIP-seq
MIRT922850	hsa-miR-4672	CLIP-seq
MIRT922851	hsa-miR-4675	CLIP-seq
MIRT922852	hsa-miR-4676-5p	CLIP-seq
MIRT922853	hsa-miR-4690-5p	CLIP-seq
MIRT922854	hsa-miR-4692	CLIP-seq
MIRT922855	hsa-miR-4693-3p	CLIP-seq
MIRT922856	hsa-miR-4700-5p	CLIP-seq
MIRT922857	hsa-miR-4701-3p	CLIP-seq
MIRT922858	hsa-miR-4703-5p	CLIP-seq
MIRT922859	hsa-miR-4710	CLIP-seq
MIRT922860	hsa-miR-4731-5p	CLIP-seq
MIRT922861	hsa-miR-4741	CLIP-seq
MIRT922862	hsa-miR-4742-3p	CLIP-seq
MIRT922863	hsa-miR-4763-3p	CLIP-seq
MIRT922864	hsa-miR-4775	CLIP-seq
MIRT922865	hsa-miR-4789-5p	CLIP-seq
MIRT922866	hsa-miR-4792	CLIP-seq
MIRT922867	hsa-miR-500b	CLIP-seq
MIRT922868	hsa-miR-509-3p	CLIP-seq
MIRT922869	hsa-miR-511	CLIP-seq
MIRT922870	hsa-miR-532-5p	CLIP-seq
MIRT922871	hsa-miR-562	CLIP-seq
MIRT922872	hsa-miR-564	CLIP-seq
MIRT922873	hsa-miR-575	CLIP-seq
MIRT922874	hsa-miR-593	CLIP-seq
MIRT922875	hsa-miR-618	CLIP-seq
MIRT922876	hsa-miR-637	CLIP-seq
MIRT922877	hsa-miR-656	CLIP-seq
MIRT922878	hsa-miR-663	CLIP-seq
MIRT922879	hsa-miR-761	CLIP-seq
MIRT922880	hsa-miR-762	CLIP-seq
MIRT922881	hsa-miR-939	CLIP-seq
MIRT922882	hsa-miR-940	CLIP-seq
MIRT922816	hsa-miR-214	CLIP-seq
MIRT922827	hsa-miR-3619-5p	CLIP-seq
MIRT922879	hsa-miR-761	CLIP-seq
MIRT1973399	hsa-miR-1205	CLIP-seq
MIRT922808	hsa-miR-1207-5p	CLIP-seq
MIRT1973400	hsa-miR-1284	CLIP-seq
MIRT922812	hsa-miR-145	CLIP-seq
MIRT1973401	hsa-miR-147	CLIP-seq
MIRT922814	hsa-miR-183	CLIP-seq
MIRT1973402	hsa-miR-1915	CLIP-seq
MIRT1973403	hsa-miR-1972	CLIP-seq
MIRT922816	hsa-miR-214	CLIP-seq
MIRT1973404	hsa-miR-300	CLIP-seq
MIRT922819	hsa-miR-3120-3p	CLIP-seq
MIRT922820	hsa-miR-3150a-3p	CLIP-seq
MIRT1973405	hsa-miR-3151	CLIP-seq
MIRT922821	hsa-miR-3175	CLIP-seq
MIRT1973406	hsa-miR-3192	CLIP-seq
MIRT1973407	hsa-miR-320a	CLIP-seq
MIRT1973408	hsa-miR-320b	CLIP-seq
MIRT1973409	hsa-miR-320c	CLIP-seq
MIRT1973410	hsa-miR-320d	CLIP-seq
MIRT1973411	hsa-miR-331-3p	CLIP-seq
MIRT1973412	hsa-miR-338-5p	CLIP-seq
MIRT922827	hsa-miR-3619-5p	CLIP-seq
MIRT1973413	hsa-miR-3689a-3p	CLIP-seq
MIRT1973414	hsa-miR-3689c	CLIP-seq
MIRT1973415	hsa-miR-381	CLIP-seq
MIRT1973416	hsa-miR-3911	CLIP-seq
MIRT1973417	hsa-miR-4264	CLIP-seq
MIRT1973418	hsa-miR-4292	CLIP-seq
MIRT1973419	hsa-miR-4429	CLIP-seq
MIRT1973420	hsa-miR-4447	CLIP-seq
MIRT1973421	hsa-miR-4472	CLIP-seq
MIRT922844	hsa-miR-4530	CLIP-seq
MIRT1973422	hsa-miR-4640-5p	CLIP-seq
MIRT1973423	hsa-miR-4650-5p	CLIP-seq
MIRT1973424	hsa-miR-4651	CLIP-seq
MIRT1973425	hsa-miR-4666-3p	CLIP-seq
MIRT922849	hsa-miR-4667-5p	CLIP-seq
MIRT922850	hsa-miR-4672	CLIP-seq
MIRT922852	hsa-miR-4676-5p	CLIP-seq
MIRT1973426	hsa-miR-4685-5p	CLIP-seq
MIRT922853	hsa-miR-4690-5p	CLIP-seq
MIRT922856	hsa-miR-4700-5p	CLIP-seq
MIRT1973427	hsa-miR-4726-3p	CLIP-seq
MIRT1973428	hsa-miR-4726-5p	CLIP-seq
MIRT1973429	hsa-miR-4728-5p	CLIP-seq
MIRT922863	hsa-miR-4763-3p	CLIP-seq
MIRT922865	hsa-miR-4789-5p	CLIP-seq
MIRT1973430	hsa-miR-4797-3p	CLIP-seq
MIRT1973431	hsa-miR-491-5p	CLIP-seq
MIRT922872	hsa-miR-564	CLIP-seq
MIRT922873	hsa-miR-575	CLIP-seq
MIRT1973432	hsa-miR-608	CLIP-seq
MIRT922876	hsa-miR-637	CLIP-seq
MIRT1973433	hsa-miR-644	CLIP-seq
MIRT922879	hsa-miR-761	CLIP-seq
MIRT922881	hsa-miR-939	CLIP-seq
MIRT1973399	hsa-miR-1205	CLIP-seq
MIRT922808	hsa-miR-1207-5p	CLIP-seq
MIRT922814	hsa-miR-183	CLIP-seq
MIRT2208992	hsa-miR-1909	CLIP-seq
MIRT1973403	hsa-miR-1972	CLIP-seq
MIRT922816	hsa-miR-214	CLIP-seq
MIRT922820	hsa-miR-3150a-3p	CLIP-seq
MIRT2208993	hsa-miR-3155	CLIP-seq
MIRT2208994	hsa-miR-3155b	CLIP-seq
MIRT922821	hsa-miR-3175	CLIP-seq
MIRT2208995	hsa-miR-3184	CLIP-seq
MIRT1973406	hsa-miR-3192	CLIP-seq
MIRT1973407	hsa-miR-320a	CLIP-seq
MIRT1973408	hsa-miR-320b	CLIP-seq
MIRT1973409	hsa-miR-320c	CLIP-seq
MIRT1973410	hsa-miR-320d	CLIP-seq
MIRT1973411	hsa-miR-331-3p	CLIP-seq
MIRT922827	hsa-miR-3619-5p	CLIP-seq
MIRT2208996	hsa-miR-3665	CLIP-seq
MIRT1973413	hsa-miR-3689a-3p	CLIP-seq
MIRT1973414	hsa-miR-3689c	CLIP-seq
MIRT2208997	hsa-miR-423-5p	CLIP-seq
MIRT2208998	hsa-miR-4268	CLIP-seq
MIRT2208999	hsa-miR-4286	CLIP-seq
MIRT1973418	hsa-miR-4292	CLIP-seq
MIRT1973419	hsa-miR-4429	CLIP-seq
MIRT2209000	hsa-miR-4505	CLIP-seq
MIRT922843	hsa-miR-4514	CLIP-seq
MIRT922844	hsa-miR-4530	CLIP-seq
MIRT922849	hsa-miR-4667-5p	CLIP-seq
MIRT2209001	hsa-miR-4688	CLIP-seq
MIRT922853	hsa-miR-4690-5p	CLIP-seq
MIRT922854	hsa-miR-4692	CLIP-seq
MIRT922856	hsa-miR-4700-5p	CLIP-seq
MIRT1973429	hsa-miR-4728-5p	CLIP-seq
MIRT2209002	hsa-miR-4736	CLIP-seq
MIRT922863	hsa-miR-4763-3p	CLIP-seq
MIRT2209003	hsa-miR-484	CLIP-seq
MIRT2209004	hsa-miR-485-5p	CLIP-seq
MIRT2209005	hsa-miR-486-3p	CLIP-seq
MIRT922872	hsa-miR-564	CLIP-seq
MIRT922876	hsa-miR-637	CLIP-seq
MIRT2209006	hsa-miR-657	CLIP-seq
MIRT922879	hsa-miR-761	CLIP-seq
MIRT922881	hsa-miR-939	CLIP-seq
MIRT922882	hsa-miR-940	CLIP-seq
MIRT1973402	hsa-miR-1915	CLIP-seq
MIRT2386699	hsa-miR-2467-3p	CLIP-seq
MIRT2208999	hsa-miR-4286	CLIP-seq
MIRT2386700	hsa-miR-4493	CLIP-seq
MIRT1973427	hsa-miR-4726-3p	CLIP-seq
MIRT922876	hsa-miR-637	CLIP-seq
MIRT2512839	hsa-miR-1291	CLIP-seq
MIRT2512840	hsa-miR-296-5p	CLIP-seq
MIRT2512841	hsa-miR-3064-5p	CLIP-seq
MIRT2512842	hsa-miR-3173-5p	CLIP-seq
MIRT922823	hsa-miR-3189-3p	CLIP-seq
MIRT1973411	hsa-miR-331-3p	CLIP-seq
MIRT2512843	hsa-miR-4257	CLIP-seq
MIRT2512844	hsa-miR-4312	CLIP-seq
MIRT2512845	hsa-miR-4645-5p	CLIP-seq
MIRT2512846	hsa-miR-4673	CLIP-seq
MIRT2512847	hsa-miR-604	CLIP-seq
MIRT2512848	hsa-miR-635	CLIP-seq
MIRT2512849	hsa-miR-647	CLIP-seq
MIRT2512850	hsa-miR-767-3p	CLIP-seq
MIRT2512839	hsa-miR-1291	CLIP-seq
MIRT2512842	hsa-miR-3173-5p	CLIP-seq
MIRT2512843	hsa-miR-4257	CLIP-seq
MIRT2512850	hsa-miR-767-3p	CLIP-seq

Show/Hide all (46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004465	Function	Lipoprotein lipase activity	IBA
GO:0005515	Function	Protein binding	IPI	23502535, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006639	Process	Acylglycerol metabolic process	IEA
GO:0006640	Process	Monoacylglycerol biosynthetic process	IEA
GO:0007405	Process	Neuroblast proliferation	IEA
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019369	Process	Arachidonate metabolic process	IBA
GO:0019369	Process	Arachidonate metabolic process	IDA	14610053
GO:0019369	Process	Arachidonate metabolic process	IEA
GO:0019369	Process	Arachidonate metabolic process	TAS
GO:0022008	Process	Neurogenesis	IEA
GO:0031901	Component	Early endosome membrane	IDA	27595600
GO:0031901	Component	Early endosome membrane	IEA
GO:0032590	Component	Dendrite membrane	IBA
GO:0032590	Component	Dendrite membrane	IDA	27595600
GO:0032590	Component	Dendrite membrane	IEA
GO:0032591	Component	Dendritic spine membrane	IEA
GO:0032591	Component	Dendritic spine membrane	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043196	Component	Varicosity	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IBA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0046340	Process	Diacylglycerol catabolic process	IBA
GO:0046340	Process	Diacylglycerol catabolic process	IDA	14610053
GO:0046340	Process	Diacylglycerol catabolic process	IMP	23502535
GO:0046872	Function	Metal ion binding	IEA
GO:0047372	Function	Monoacylglycerol lipase activity	IEA
GO:0047372	Function	Monoacylglycerol lipase activity	TAS
GO:0098839	Component	Postsynaptic density membrane	IDA	27595600
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098921	Process	Retrograde trans-synaptic signaling by endocannabinoid	IBA
GO:0098921	Process	Retrograde trans-synaptic signaling by endocannabinoid	IEA
GO:0098921	Process	Retrograde trans-synaptic signaling by endocannabinoid	IMP	23502535
GO:0098921	Process	Retrograde trans-synaptic signaling by endocannabinoid	ISS
GO:0150077	Process	Regulation of neuroinflammatory response	IEA
GO:0150077	Process	Regulation of neuroinflammatory response	ISS
GO:1901696	Process	Cannabinoid biosynthetic process	IEA

MIM	HGNC	e!Ensembl
614015	1165	ENSG00000134780

Q9Y4D2

Protein name

Diacylglycerol lipase-alpha (DAGL-alpha) (DGL-alpha) (EC 3.1.1.116) (Neural stem cell-derived dendrite regulator) (Sn1-specific diacylglycerol lipase alpha)

Protein function

Serine hydrolase that hydrolyzes arachidonic acid-esterified diacylglycerols (DAGs) to produce the principal endocannabinoid, 2-arachidonoylglycerol (2-AG) (PubMed:14610053, PubMed:23502535, PubMed:26668358). Preferentially hydrolyzes sn-1 fatty

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01764	Lipase_3	394 → 533	Lipase (class 3)	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in brain and pancreas. {ECO:0000269|PubMed:14610053, ECO:0000269|PubMed:16051747}.

Sequence

MPGIVVFRRRWSVGSDDLVLPAIFLFLLHTTWFVILSVVLFGLVYNPHEACSLNLVDHGR
GYLGILLSCMIAEMAIIWLSMRGGILYTEPRDSMQYVLYVRLAILVIEFIYAIVGIVWLT
QYYTSCNDLTAKNVTLGMVVCNWVVILSVCITVLCVFDPTGRTFVKLRATKRRQRNLRTY
NLRHRLEEGQATSWSRRLKVFLCCTRTKDSQSDAYSEIAYLFAEFFRDLDIVPSDIIAGL
VLLRQRQRAKRNAVLDEANNDILAFLSGMPVTRNTKYLDLKNSQEMLRYKEVCYYMLFAL
AAYGWPMYLMRKPACGLCQLARSCSCCLCPARPRFAPGVTIEEDNCCGCNAIAIRRHFLD
ENMTAVDIVYTSCHDAVYETPFYVAVDHDKKKVVISIRGTLSPKDALTDLTGDAERLPVE
GHHGTWLGHKGMVLSAEYIKKKLEQEMVLSQAFGRDLGRGTKHYGLIVVGHSLGAGTAAI
LSFLLRPQYPTLKCFAYSPPGGLLSEDAMEYSKEFVTAVVLGKDLVPRIGLSQLEGFRRQ
LLDVLQRSTKPKWRIIVGATKCIPKSELPEEVEVTTLASTRLWTHPSDLTIALSASTPLY
PPGRIIHVVHNHPAEQCCCCEQEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLN
KVLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPLPTGPPMPTGLALELPTADHRN
SSVRSKSQSEMSLEGFSEGRLLSPVVAAAARQDPVELLLLSTQERLAAELQARRAPLATM
ESLSDTESLYSFDSRRSSGFRSIRGSPSLHAVLERDEGHLFYIDPAIPEENPSLSSRTEL
LAADSLSKHSQDTQPLEAALGSGGVTPERPPSAAANDEEEEVGGGGGGPASRGELALHNG
RLGDSPSPQVLEFAEFIDSLFNLDSKSSSFQDLYCMVVPESPTSDYAEGPKSPSQQEILL
RAQFEPNLVPKPPRLFAGSADPSSGISLSPSFPLSSSGELMDLTPTGLSSQECLAADKIR
TSTPTGHGASPAKQDELVISAR

Sequence length

1042

Interactions

View interactions

	KEGG		Reactome
	Retrograde endocannabinoid signaling Aldosterone synthesis and secretion		Arachidonate production from DAG

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Benign paroxysmal tonic upgaze of childhood with ataxia	Pathogenic	rs2540756572, rs2540756298, rs998640015, rs2540756474	RCV004526288 RCV004526296 RCV004526297 RCV004526299	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Attention deficit hyperactivity disorder	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
AUTISTIC DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT CEREBELLAR ATAXIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DAGLA-related disorder	Benign; Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROOCULAR SYNDROME 2, PAROXYSMAL TYPE	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (19)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Ataxia	Ataxia	Pubtator	35737950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	28332277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	29145497		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	29145497	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Diseases	Brain disease	Pubtator	29145497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37414748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	30787385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	29145497, 35737950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	29614312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25592173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	30718901		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29614312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	29145497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus Pathologic	Nystagmus	Pubtator	35737950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24616451	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36852447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carnitine transport defect	Renal Carnitine Transport Defect	BEFREE	27394933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22036037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	29145497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DAGLA (diacylglycerol lipase alpha)